Rv1269c
- Type
- protein_coding
- Name
- Rv1269c
- Locus Name
-
Rv1269c
- Product
-
Conserved probable secreted protein
- Functional Category
-
Cell wall and cell processes
- Location
- 1418579..1418953 (- strand)
- Gene Length
- 374 bp
- Nucleotides
-
ATGACGACGATGATTACTCTTCGGCGACGGTTCGCGGTGGCCGTCGCCGGCGTCGCCACTGCCGCCGCGACGACCGTCACCCTGGCTCCCGCACCAGCAAATGCCGCCGATGTCTATGGCGCAATTGCCTACTCCGGCAACGGCTCGTGGGGCCGATCGTGGGACTACCCAACCCGGGCGGCTGCCGAAGCCACCGCCGTCAAGTCGTGTGGCTACTCCGACTGCAAGGTGCTCACCAGTTTCACCGCCTGCGGCGCCGTCGCCGCCAACGATAGGGCATACCAGGGAGGAGTTGGACCCACCTTGGCCGCCGCCATGAAGGACGCCCTGACCAAGCTCGGCGGCGGCTACATCGACACCTGGGCCTGCAACTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- InterPro
Summary
- Name
- Protein Rv1269c
- Family
- Unknown
- Protein Sequence
-
MTTMITLRRRFAVAVAGVATAAATTVTLAPAPANAADVYGAIAYSGNGSWGRSWDYPTRAAAEATAVKSCGYSDCKVLTSFTACGAVAANDRAYQGGVGPTLAAAMKDALTKLGGGYIDTWACN
- Mass
- 12,550 Da
- Length
- 124 Aa
Rv1269c doesn't seem to be a targeted by any drug.
Rv1269c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Identification of acidic, low molecular mass proteins of Mycobacterium tuberculosis strain H37Rv by matrix-assisted laser desorption/ionization and electrospray ionization mass spectrometry.
- Proteomics. 2001 Apr;1(4):494-507. doi: 10.1002/1615-9861(200104)1:4<494::AID-PROT494>3.0.CO;2-4.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.