lprA
- Type
- protein_coding
- Name
- lprA
- Locus Name
-
Rv1270c
- Product
-
Possible lipoprotein LprA
- Functional Category
-
Cell wall and cell processes
- Location
- 1419014..1419748 (- strand)
- Gene Length
- 734 bp
- Nucleotides
-
ATGAAGCATCCACCTTGTTCCGTTGTTGCCGCCGCCACCGCCATACTCGCCGTCGTCCTGGCGATCGGCGGCTGCTCAACCGAAGGGGACGCCGGCAAAGCGTCTGACACCGCGGCCACGGCATCCAACGGCGATGCGGCCATGCTACTCAAGCAGGCCACCGATGCGATGCGCAAGGTCACCGGAATGCACGTCAGACTTGCGGTGACAGGCGACGTGCCAAACCTGCGGGTGACCAAGCTCGAAGGCGATATCTCCAACACACCGCAGACGGTTGCCACCGGTAGCGCGACATTGCTCGTCGGCAACAAGAGCGAAGACGCGAAGTTCGTCTATGTTGACGGTCACCTGTACTCCGACCTAGGCCAGCCCGGCACCTACACCGATTTCGGCAACGGCGCCTCGATCTACAACGTGTCGGTGCTCCTCGACCCCAACAAGGGCCTGGCCAACCTGTTGGCTAACCTCAAGGACGCGTCGGTTGCCGGCAGCCAGCAGGCGGACGGTGTCGCGACCACCAAGATCACCGGGAACTCGTCTGCTGACGACATCGCGACGCTGGCCGGCTCACGTCTGACCTCCGAAGACGTCAAAACGGTGCCCACCACCGTCTGGATCGCTTCGGATGGATCCTCGCACTTGGTCCAGATCCAGATCGCTCCCACCAAAGACACGTCGGTGACGTTGACGATGTCCGACTGGGGTAAGCAGGTCACCGCCACCAAACCGGTCTA
- Drug Resistance
- Mutations
- Function
- Constitutes a host TLR2 agonist (toll-like receptor), shown experimentally for human and mouse (PubMed:19362712). In host cells full-length (acylated) protein acts as a TLR2 agonist, inducing human and murine macrophages to produce cytokines, inducing murine dendritic cell maturation and cytokine production and inhibiting antibody processing in murine macrophages (PubMed:16785538). Binds diacylated phosphatidyl-myo-inositol mannosides (PIMs) (PubMed:20694006). Does not induce murine macrophage apoptosis or necrosis (PubMed:16785538). Non-acylated protein does not act as a TLR2 agonist (PubMed:20694006). Requires only host TLR2 as receptors to elicit host response in mouse, although TLR6 may play a redundant role, also requires CD14 and CD16 as accessory receptors (PubMed:19362712). {ECO:0000269|PubMed:16785538, ECO:0000269|PubMed:19362712, ECO:0000269|PubMed:20694006}.
- Family
-
LppX/LprAFG lipoprotein family
- GO
-
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- active evasion of host immune response via regulation of host cytokine network GO:0042785 biological_process
- lipid binding GO:0008289 molecular_function
- receptor ligand activity GO:0048018 molecular_function
- InterPro
Summary
- Name
- Lipoprotein LprA
- Family
- LppX/LprAFG lipoprotein family
- Protein Sequence
-
MKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLLKQATDAMRKVTGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLLVGNKSEDAKFVYVDGHLYSDLGQPGTYTDFGNGASIYNVSVLLDPNKGLANLLANLKDASVAGSQQADGVATTKITGNSSADDIATLAGSRLTSEDVKTVPTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTATKPV
- Mass
- 24,874 Da
- Length
- 244 Aa
Rv1270c doesn't seem to be a targeted by any drug.
-
-
Tuberculosis mtu05152
mtu05152Human Diseases; Infectious disease: bacterial
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Regulation of antigen presentation by Mycobacterium tuberculosis: a role for Toll-like receptors.
- Nat Rev Microbiol. 2010 Apr;8(4):296-307. doi: 10.1038/nrmicro2321.
- Mycobacterium tuberculosis lipoprotein LprG (Rv1411c) binds triacylated glycolipid agonists of Toll-like receptor 2.
- Nat Struct Mol Biol. 2010 Sep;17(9):1088-95. doi: 10.1038/nsmb.1869. Epub 2010 Aug 8.
- TLR2 and its co-receptors determine responses of macrophages and dendritic cells to lipoproteins of Mycobacterium tuberculosis.
- Cell Immunol. 2009;258(1):29-37. doi: 10.1016/j.cellimm.2009.03.008. Epub 2009 Apr 11.
- Mycobacterium tuberculosis LprA is a lipoprotein agonist of TLR2 that regulates innate immunity and APC function.
- J Immunol. 2006 Jul 1;177(1):422-9. doi: 10.4049/jimmunol.177.1.422.
- Mycobacterium tuberculosis LprG (Rv1411c): a novel TLR-2 ligand that inhibits human macrophage class II MHC antigen processing.
- J Immunol. 2004 Aug 15;173(4):2660-8. doi: 10.4049/jimmunol.173.4.2660.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.