hemK
- Type
- protein_coding
- Name
- hemK
- Locus Name
-
Rv1300
- Product
-
Probable HemK protein homolog HemK
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1456565..1457542 (+ strand)
- Gene Length
- 977 bp
- Nucleotides
-
TGACCTCCGCGCCGGCGACGATGCGGTGGGGGAACCTCCCGCTTGCGGGGGAGAGCGGCACAATGACCCTGCGTCAGGCGATCGACTTGGCTGCTGCGCTATTGGCCGAAGCGGGGGTCGACTCGGCGCGTTGCGACGCTGAGCAGTTGGCCGCTCACCTAGCGGGCACAGACCGCGGTAGGCTACCCCTGTTCGAGCCGCCCGGCGACGAGTTCTTCGGGCGCTATCGCGACATCGTCACCGCTCGTGCGCGGCGGGTGCCGTTGCAGCATCTCATCGGGACTGTGTCGTTTGGGCCCGTGGTGCTGCATGTCGGCCCGGGTGTGTTTGTACCGCGTCCGGAGACCGAAGCCATTTTGGCCTGGGCCACCGCGCAGTCGCTGCCGGCGCGGCCGCTGATTGTCGACGCATGCACGGGATCTGGCGCGTTGGCGGTCGCATTGGCCCAGCACCGGGCCAACCTTGGACTAAAGGCCCGCATCATCGGCATTGACGACTCCGACTGCGCCCTTGACTATGCCCGCCGCAATGCGGCGGGTACCCCGGTAGAGTTGGTGCGTGCCGACGTCACCACGCCCCGCCTGCTCCCCGAACTCGACGGACAAGTCGACCTGATGGTTTCCAACCCGCCCTACATCCCTGATGCTGCTGTTTTGGAACCTGAAGTAGCGCAACATGACCCGCATCACGCGTTGTTCGGCGGTCCCGACGGGATGACGGTGATATCCGCGGTCGTCGGGCTTGCTGGGCGCTGGCTGCGTCCCGGTGGCCTGTTCGCCGTCGAACACGACGACACCACGTCGTCGTCAACTGTCGATTTGGTCAGCAGCACAAAACTTTTCGTGGACGTACAAGCCCGGAAAGATCTGGCCGGACGGCCGAGGTTTGTGACGGCGATGAGGTGGGGGCACCTCCCGCTTGCAGGGGAGAACGGCGCCATTGACCCGCGCCAGCGACGATGCAGAGCGAAGCGATGA
- Drug Resistance
- Mutations
- Function
- Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif. {ECO:0000255|HAMAP-Rule:MF_02126}.
- Family
-
Protein N5-glutamine methyltransferase family, PrmC subfamily
- GO
-
- nucleic acid binding GO:0003676 molecular_function
- peptidyl-glutamine methylation GO:0018364 biological_process
- protein-glutamine N-methyltransferase activity GO:0036009 molecular_function
- protein-(glutamine-N5) methyltransferase activity GO:0102559 molecular_function
- InterPro
Summary
- Name
- Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (M.MtuHHemKP) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC)
- Family
- Protein N5-glutamine methyltransferase family, PrmC subfamily
- Protein Sequence
-
MTLRQAIDLAAALLAEAGVDSARCDAEQLAAHLAGTDRGRLPLFEPPGDEFFGRYRDIVTARARRVPLQHLIGTVSFGPVVLHVGPGVFVPRPETEAILAWATAQSLPARPLIVDACTGSGALAVALAQHRANLGLKARIIGIDDSDCALDYARRNAAGTPVELVRADVTTPRLLPELDGQVDLMVSNPPYIPDAAVLEPEVAQHDPHHALFGGPDGMTVISAVVGLAGRWLRPGGLFAVEHDDTTSSSTVDLVSSTKLFVDVQARKDLAGRPRFVTAMRWGHLPLAGENGAIDPRQRRCRAKR
- Mass
- 32,459 Da
- Length
- 304 Aa
Rv1300 doesn't seem to be a targeted by any drug.
Rv1300 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.