atpE
- Type
- protein_coding
- Name
- atpE
- Locus Name
-
Rv1305
- Product
-
Probable ATP synthase C chain AtpE (lipid-binding protein) (dicyclohexylcarbodiimide-binding protein)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1461045..1461290 (+ strand)
- Gene Length
- 245 bp
- Nucleotides
-
TGGACCCCACTATCGCTGCCGGCGCCCTCATCGGCGGTGGACTGATCATGGCCGGTGGCGCCATCGGCGCCGGTATCGGTGACGGTGTCGCCGGTAACGCGCTTATCTCCGGTGTCGCCCGGCAACCCGAGGCGCAAGGGCGGCTGTTCACACCGTTCTTCATCACCGTCGGTTTGGTTGAGGCGGCATACTTCATCAACCTGGCGTTTATGGCGCTGTTCGTCTTCGCTACACCCGTCAAGTAA
- Drug Resistance
- Mutations
- Function
- F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; FUNCTION: Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}.
- Family
-
ATPase C chain family
- GO
-
- proton transmembrane transport GO:1902600 biological_process
- proton-transporting ATP synthase activity, rotational mechanism GO:0046933 molecular_function
- ATP synthesis coupled proton transport GO:0015986 biological_process
- plasma membrane GO:0005886 cellular_component
- lipid binding GO:0008289 molecular_function
- proton-transporting ATP synthase complex, coupling factor F(o) GO:0045263 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein)
- Family
- ATPase C chain family
- Protein Sequence
-
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK
- Mass
- 8,055 Da
- Length
- 81 Aa
- Bedaquiline DB08903
-
1-(6-Bromo-2-methoxy-quinolin-3-yl)-4-dimethylamino-2-naphthalen-1-yl-1-phenyl-butan-2-ol | Bedaquilina | Bedaquilinum | R 207910 | TMC 207 | TMC-207 | TMC207
-
-
Oxidative phosphorylation mtu00190
mtu00190PATHWAY_MAP mtu00190 Oxidative phosphorylation
-
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.