atpC
- Type
- protein_coding
- Name
- atpC
- Locus Name
-
Rv1311
- Product
-
Probable ATP synthase epsilon chain AtpC
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1467315..1467680 (+ strand)
- Gene Length
- 365 bp
- Nucleotides
-
TGGCCGAATTGAACGTTGAGATCGTCGCCGTCGACCGGAACATCTGGTCGGGTACGGCGAAGTTTCTGTTCACCCGCACCACCGTCGGTGAGATCGGCATCCTGCCCCGCCACATTCCGTTGGTGGCCCAATTGGTCGATGACGCCATGGTGCGGGTCGAGCGGGAGGGAGAAAAGGACCTGAGGATCGCGGTCGACGGCGGGTTCCTGTCGGTGACCGAGGAGGGCGTCAGCATTCTCGCCGAATCTGCCGAGTTCGAGTCGGAGATCGACGAGGCCGCCGCCAAGCAGGATTCCGAATCCGACGATCCCCGCATCGCTGCCAGGGGCCGCGCCAGATTGCGCGCCGTCGGCGCGATCGACTAA
- Drug Resistance
- Mutations
- Function
- Produces ATP from ADP in the presence of a proton gradient across the membrane. {ECO:0000250}.
- Family
-
ATPase epsilon chain family
- GO
-
- proton-transporting ATP synthase activity, rotational mechanism GO:0046933 molecular_function
- ATP synthesis coupled proton transport GO:0015986 biological_process
- cell wall GO:0005618 cellular_component
- ATP binding GO:0005524 molecular_function
- plasma membrane GO:0005886 cellular_component
- proton-transporting ATP synthase complex, catalytic core F(1) GO:0045261 cellular_component
- InterPro
2LX5
- Name
- ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)
- Family
- ATPase epsilon chain family
- Protein Sequence
-
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKDLRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAID
- Mass
- 13,135 Da
- Length
- 121 Aa
Summary
Rv1311 doesn't seem to be a targeted by any drug.
-
-
Oxidative phosphorylation mtu00190
mtu00190PATHWAY_MAP mtu00190 Oxidative phosphorylation
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.