ogt
- Type
- protein_coding
- Name
- ogt
- Locus Name
-
Rv1316c
- Product
-
Methylated-DNA--protein-cysteine methyltransferase Ogt (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-alkyltransferase)
- Functional Category
-
Information pathways
- Location
- 1477134..1477631 (- strand)
- Gene Length
- 497 bp
- Nucleotides
-
ATGATTCACTACCGCACCATCGATAGCCCCATCGGGCCATTAACCCTGGCCGGGCATGGCTCGGTGTTGACGAACCTGCGGATGCTCGAGCAGACGTATGAGCCAAGCCGCACACACTGGACACCCGACCCCGGCGCATTTTCTGGCGCTGTCGACCAACTCAACGCTTATTTCGCCGGCGAGCTCACCGAATTCGATGTGGAACTTGACCTCCGGGGAACCGACTTTCAGCAACGAGTATGGAAAGCATTGCTGACAATCCCGTACGGGGAAACCCGGTCCTACGGGGAAATCGCCGACCAGATCGGCGCCCCCGGCGCCGCACGCGCCGTGGGATTGGCCAACGGCCACAATCCCATCGCCATCATCGTCCCGTGCCACCGCGTGATCGGCGCCAGCGGAAAGCTCACCGGGTACGGCGGTGGAATCAACCGGAAACGAGCTCTGCTCGAGTTGGAGAAAAGCCGGGCGCCCGCAGACTTGACGCTCTTCGACTG
- Drug Resistance
- Mutations
- Function
- Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. {ECO:0000255|HAMAP-Rule:MF_00772}.
- Family
-
MGMT family
- GO
-
- methylated-DNA-[protein]-cysteine S-methyltransferase activity GO:0003908 molecular_function
- DNA dealkylation involved in DNA repair GO:0006307 biological_process
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- response to nitrosative stress GO:0051409 biological_process
- InterPro
4BHB
- Name
- Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase)
- Family
- MGMT family
- Protein Sequence
-
MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD
- Mass
- 17,858 Da
- Length
- 165 Aa
Summary
Rv1316c doesn't seem to be a targeted by any drug.
Rv1316c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.