cysO
- Type
- protein_coding
- Name
- cysO
- Locus Name
-
Rv1335
- Product
-
Sulfur carrier protein CysO
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1503103..1503384 (+ strand)
- Gene Length
- 281 bp
- Nucleotides
-
TGAACGTCACCGTATCCATTCCGACCATCCTGCGGCCCCACACCGGCGGCCAGAAGAGTGTCTCGGCCAGCGGCGATACCTTGGGTGCCGTCATCAGCGACCTGGAGGCCAACTATTCGGGCATTTCCGAGCGCCTGATGGACCCGTCTTCCCCAGGTAAGTTGCACCGCTTCGTGAACATCTACGTCAACGACGAGGACGTGCGGTTCTCCGGCGGCTTGGCCACCGCGATCGCTGACGGTGACTCGGTCACCATCCTCCCCGCCGTGGCCGGTGGGTGA
- Drug Resistance
- Mutations
- Function
- In its thiocarboxylated form (CysO-COSH), is the sulfur donor in the CysM-dependent cysteine biosynthetic pathway. May be of particular importance for cysteine biosynthesis in the persistent phase of M.tuberculosis. {ECO:0000269|PubMed:16104727, ECO:0000269|PubMed:18799456, ECO:0000269|PubMed:18842002}.
- Family
-
Sulfur carrier protein CysO family
- GO
-
- cysteine biosynthetic process GO:0019344 biological_process
- protein-containing complex GO:0032991 cellular_component
- cytosol GO:0005829 cellular_component
- InterPro
3DWG
- Name
- Sulfur carrier protein CysO (9.5 kDa culture filtrate antigen cfp10A)
- Family
- Sulfur carrier protein CysO family
- Protein Sequence
-
MNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG
- Mass
- 9,557 Da
- Length
- 93 Aa
Summary
Rv1335 doesn't seem to be a targeted by any drug.
-
-
Cysteine synthesis from O-phosphoserine R-MTU-936654
Mycobacterium tuberculosisR-MTU-936654
-
- Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis.
- Biochemistry. 2008 Sep 30;47(39):10354-64. doi: 10.1021/bi800915j. Epub 2008 Sep 5.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Cysteine synthase (CysM) of Mycobacterium tuberculosis is an O-phosphoserine sulfhydrylase: evidence for an alternative cysteine biosynthesis pathway in mycobacteria.
- J Biol Chem. 2008 Nov 14;283(46):31567-74. doi: 10.1074/jbc.M804877200. Epub 2008 Sep 16.
- O-phospho-L-serine and the thiocarboxylated sulfur carrier protein CysO-COSH are substrates for CysM, a cysteine synthase from Mycobacterium tuberculosis.
- Biochemistry. 2008 Nov 4;47(44):11606-15. doi: 10.1021/bi8013664. Epub 2008 Oct 9.
- Reconstitution of a new cysteine biosynthetic pathway in Mycobacterium tuberculosis.
- J Am Chem Soc. 2005 Aug 24;127(33):11602-3. doi: 10.1021/ja053476x.
- Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression.
- Mol Microbiol. 2002 Jul;45(2):365-74.
- Identification of acidic, low molecular mass proteins of Mycobacterium tuberculosis strain H37Rv by matrix-assisted laser desorption/ionization and electrospray ionization mass spectrometry.
- Proteomics. 2001 Apr;1(4):494-507. doi: 10.1002/1615-9861(200104)1:4<494::AID-PROT494>3.0.CO;2-4.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.