mbtL
- Type
- protein_coding
- Name
- mbtL
- Locus Name
-
Rv1344
- Product
-
Acyl carrier protein (ACP) MbtL
- Functional Category
-
Lipid metabolism
- Location
- 1508968..1509288 (+ strand)
- Gene Length
- 320 bp
- Nucleotides
-
TGTGGCGATATCCACTAAGTACAAGGCTAGCCTTGCCTAATACCCCAGGTGTAGCCTCCTTCGCCATGACCTCATCGCCGTCCACCGTCAGCACTACGCTGCTGAGCATCCTGCGCGACGACCTCAACATTGACCTGACTCGAGTCACGCCTGATGCCAGGTTGGTCGACGATGTGGGACTGGATTCGGTGGCCTTCGCGGTCGGTATGGTGGCCATCGAGGAGCGGCTCGGAGTCGCACTGTCCGAAGAGGAGCTCTTGACGTGCGACACGGTCGGAGAACTGGAGGCAGCGATCGCGGCCAAATACCGCGATGAGTGA
- Drug Resistance
- Mutations
- Function
- Acyl carrier protein involved in the formation of acyl-S-ACP intermediates within the mycobactin biosynthesis process. The aliphatic chains carried by ACP are subsequently transferred on to the mycobactin core by MbtK. {ECO:0000269|PubMed:16461464}.
- Family
-
Unknown
- GO
-
- siderophore biosynthetic process from catechol GO:0019540 biological_process
- cytoplasm GO:0005737 cellular_component
- acyl carrier activity GO:0000036 molecular_function
- InterPro
Summary
- Name
- Acyl carrier protein MbtL (ACP) (Mycobactin synthase protein L)
- Family
- Unknown
- Protein Sequence
-
MTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVGLDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE
- Mass
- 8,969 Da
- Length
- 84 Aa
Rv1344 doesn't seem to be a targeted by any drug.
Rv1344 doesn't seem to be involved in any pathway.
- A genetic locus required for iron acquisition in Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2006 Feb 14;103(7):2069-74. doi: 10.1073/pnas.0507924103. Epub 2006 Feb 3.
- ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response.
- Infect Immun. 2002 Jul;70(7):3371-81. doi: 10.1128/iai.70.7.3371-3381.2002.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.