mbtK
- Type
- protein_coding
- Name
- mbtK
- Locus Name
-
Rv1347c
- Product
-
Lysine N-acetyltransferase MbtK
- Functional Category
-
Lipid metabolism
- Location
- 1511973..1512605 (- strand)
- Gene Length
- 632 bp
- Nucleotides
-
ATGACCAAACCCACATCCGCTGGCCAGGCCGACGACGCGCTGGTTCGGCTAGCCCGCGAGCGATTCGACCTACCTGACCAGGTACGACGCCTCGCCCGCCCGCCCGTTCCATCGTTGGAGCCGCCATACGGGTTGCGGGTCGCACAGCTGACCGACGCGGAGATGTTGGCGGAGTGGATGAACCGTCCTCATCTGGCGGCGGCCTGGGAGTACGACTGGCCGGCGTCACGTTGGCGTCAACACCTGAACGCCCAACTTGAGGGAACCTATTCGTTGCCATTGATCGGCAGCTGGCACGGAACAGATGGTGGTTATCTCGAATTATACTGGGCAGCAAAGGATTTGATTTCTCACTACTACGACGCAGACCCCTACGATTTGGGGCTGCACGCGGCCATCGCGGACTTGTCGAAGGTCAATCGGGGCTTCGGCCCGCTGCTGCTACCGCGGATCGTGGCCAGCGTCTTTGCCAACGAGCCGCGTTGCCGGCGGATCATGTTCGACCCCGATCACCGCAACACCGCGACCCGTCGGTTGTGTGAGTGGGCCGGATGCAAGTTCCTCGGTGAGCATGACACGACAAACCGGCGCATGGCGCTCTACGCTTTGGAAGCTCCGACCACGGCTGCGTA
- Drug Resistance
- Mutations
- Function
- Acyltransferase required for the direct transfer of medium- to long-chain fatty acyl moieties from a carrier protein (MbtL) on to the epsilon-amino group of lysine residue in the mycobactin core. {ECO:0000269|PubMed:16461464}.
- Family
-
Lysine N-acyltransferase MbtK family
- GO
-
- siderophore biosynthetic process from catechol GO:0019540 biological_process
- acyl-CoA hydrolase activity GO:0047617 molecular_function
- N-acyltransferase activity GO:0016410 molecular_function
- transferase activity, transferring acyl groups other than amino-acyl groups GO:0016747 molecular_function
- InterPro
1YK3
- Name
- Lysine N-acyltransferase MbtK (N-acyltransferase MbtK) (EC 2.3.1.-) (Mycobactin synthase protein K)
- Family
- Lysine N-acyltransferase MbtK family
- Protein Sequence
-
MTKPTSAGQADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHGTDGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPRIVASVFANEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMALYALEAPTTAA
- Mass
- 23,799 Da
- Length
- 210 Aa
Summary
Rv1347c doesn't seem to be a targeted by any drug.
Rv1347c doesn't seem to be involved in any pathway.
- The crystal structure of Rv1347c, a putative antibiotic resistance protein from Mycobacterium tuberculosis, reveals a GCN5-related fold and suggests an alternative function in siderophore biosynthesis.
- J Biol Chem. 2005 Apr 8;280(14):13978-86. doi: 10.1074/jbc.M413904200. Epub 2005 Jan 28.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- A genetic locus required for iron acquisition in Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2006 Feb 14;103(7):2069-74. doi: 10.1073/pnas.0507924103. Epub 2006 Feb 3.
- ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response.
- Infect Immun. 2002 Jul;70(7):3371-81. doi: 10.1128/iai.70.7.3371-3381.2002.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.