PE15
- Type
- protein_coding
- Name
- PE15
- Locus Name
-
Rv1386
- Product
-
PE family protein PE15
- Functional Category
-
Pe/ppe
- Location
- 1561464..1561772 (+ strand)
- Gene Length
- 308 bp
- Nucleotides
-
TGACGTTGCGAGTCGTTCCCGAAAGCCTGGCAGGCGCCAGCGCTGCCATCGAAGCAGTGACCGCTCGCCTGGCCGCCGCGCACGCCGCGGCGGCCCCGTTTATCGCGGCGGTCATCCCGCCTGGGTCCGACTCGGTTTCGGTGTGCAACGCCGTTGAGTTCAGCGTTCACGGTAGTCAGCATGTGGCAATGGCCGCTCAGGGGGTTGAGGAGCTCGGCCGCTCGGGGGTCGGGGTGGCCGAATCGGGTGCCAGTTATGCCGCTAGGGATGCGCTGGCGGCGGCGTCGTATCTCAGCGGTGGGCTATGA
- Drug Resistance
- Mutations
- Function
- May play a pivotal role in the evasion of host immune response by M.tuberculosis. Mediates production of IL-10 via activation of the p38 and ERK1/2 mitogen-activated protein kinase (MAPK) signaling pathways. {ECO:0000269|PubMed:23284742}.
- Family
-
Mycobacterial PE family
- GO
-
- cell surface GO:0009986 cellular_component
- pathogenesis GO:0009405 biological_process
- envelope GO:0031975 cellular_component
- extracellular region GO:0005576 cellular_component
- InterPro
Summary
- Name
- PE family immunomodulator PE15
- Family
- Mycobacterial PE family
- Protein Sequence
-
MTLRVVPESLAGASAAIEAVTARLAAAHAAAAPFIAAVIPPGSDSVSVCNAVEFSVHGSQHVAMAAQGVEELGRSGVGVAESGASYAARDALAAASYLSGGL
- Mass
- 9,862 Da
- Length
- 102 Aa
Rv1386 doesn't seem to be a targeted by any drug.
Rv1386 doesn't seem to be involved in any pathway.
- Separable roles for Mycobacterium tuberculosis ESX-3 effectors in iron acquisition and virulence.
- Proc Natl Acad Sci U S A. 2016 Jan 19;113(3):E348-57. doi: 10.1073/pnas.1523321113. Epub 2016 Jan 4.
- The Mycobacterium tuberculosis PE proteins Rv0285 and Rv1386 modulate innate immunity and mediate bacillary survival in macrophages.
- PLoS One. 2012;7(12):e51686. doi: 10.1371/journal.pone.0051686. Epub 2012 Dec 17.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.