lprG



Type
protein_coding
Name
lprG
Locus Name

Rv1411c

Product

Conserved lipoprotein LprG

Functional Category

Cell wall and cell processes

Location
1587772..1588482 (- strand)
Gene Length
710 bp
Nucleotides
ATGCGGACCCCCAGACGCCACTGCCGTCGCATCGCCGTCCTCGCCGCCGTTAGCATCGCCGCCACTGTCGTTGCCGGCTGCTCGTCGGGCTCGAAGCCAAGCGGCGGACCACTTCCGGACGCGAAGCCGCTGGTCGAGGAGGCCACCGCGCAGACCAAGGCTCTCAAGAGCGCGCACATGGTGCTGACGGTCAACGGCAAGATCCCGGGACTGTCTCTGAAGACGCTGAGCGGCGATCTCACCACCAACCCCACCGCCGCGACGGGAAACGTCAAGCTCACGCTGGGTGGGTCTGATATCGATGCCGACTTCGTGGTGTTCGACGGGATCCTGTACGCCACCCTGACGCCCAACCAGTGGAGCGATTTCGGTCCCGCCGCCGACATCTACGACCCCGCCCAGGTGCTGAATCCGGATACCGGCCTGGCCAACGTGCTGGCGAATTTCGCCGACGCAAAAGCCGAAGGGCGGGATACCATCAACGGCCAGAACACCATCCGCATCAGCGGGAAGGTATCGGCACAGGCGGTGAACCAGATAGCGCCGCCGTTCAACGCGACGCAGCCGGTGCCGGCGACCGTCTGGATTCAGGAGACCGGCGATCATCAACTGGCACAGGCCCAGTTGGACCGCGGCTCGGGCAATTCCGTCCAGATGACCTTGTCGAAATGGGGCGAGAAGGTCCAGGTCACGAAGCCCCCGGTGAGCTG
Drug Resistance

Check for drug resistance association at TBDREAMDB

Mutations

Check for mutants available at TARGET


Function
Probably helps membrane protein Rv1410c (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm; TAG probably regulates lipid metabolism and growth regulation (PubMed:26751071). Binds TAG and transfers it between lipid bilayers, probably to the outer membrane in vivo (PubMed:26751071). Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2 (PubMed:20694006, PubMed:25356793). Binds LM > PIM6 > ManLAM > PI-LAM > PIM2 (mannose-capped LAM and phospho-myo-inositol-capped LAM, E.coli expressed without acyl-groups); deacylated LM and LAM also bind to this protein via their mannose moieties, showing LprG has at least 2 different ways to bind glycolipids (PubMed:25356793). Binds triacylglycerides (TAG) in the same cavity, is able to transfer TAG between lipid bilayers (PubMed:26751071). Overexpression of LprG and Rv1410c leads to increased levels of TAG in the culture medium (PubMed:26751071). Required for Rv1410c-mediated export of drugs (PubMed:18156250, PubMed:21762531). Required, probably with Rv1410c, for normal surface localization of LAM (PubMed:25232742). {ECO:0000269|PubMed:18156250, ECO:0000269|PubMed:20694006, ECO:0000269|PubMed:21762531, ECO:0000269|PubMed:25232742, ECO:0000269|PubMed:25356793, ECO:0000269|PubMed:26751071}.; FUNCTION: A host TLR2 agonist (toll-like receptor), shown experimentally for human and mouse (PubMed:19362712). Inhibits primary human macrophage MHC-II Ag processing via TLR2 (PubMed:15294983). Both lipidated and nonlipidated protein act as TLR2 agonists in antigen-presenting cells, although lipidated protein is more efficient (PubMed:20694006). In resting human CD4+ T-cells lipidated but not nonlipidated protein is a costimulatory ligand (with anti-CD3 and anti-CD28) for T-cell proliferation and IFN-gamma and IL-2 production, leading to increased expression of early T-cell activation markers, TLR2 and NFKB3 phosphorylation (PubMed:21078852). Human CD4+ T-cells use TLR1/TLR2 heterodimers to respond to this and probably other mycobacterial lipoproteins (PubMed:21078852). Able to stimulate proliferation of CD4+ T-cells derived from a human leprosy patient following protein processing/presentation by MHC class II molecules in peripheral blood mononuclear cells (PubMed:18424702). Requires both host TLR1 and TLR2 as coreceptors to elicit host response in mouse, although TLR6 may play a redundant role, has a partial requirement for CD14 as an accessory receptor (PubMed:19362712). {ECO:0000269|PubMed:15294983, ECO:0000269|PubMed:18424702, ECO:0000269|PubMed:19362712, ECO:0000269|PubMed:20694006, ECO:0000269|PubMed:21078852}.
Family

LppX/LprAFG lipoprotein family

GO
InterPro

UniProt
P9WK45
GenBank
Rv1411c
EnsemblBacteria
Rv1411c
Mycobrowser
Rv1411c


3MH8
Summary
Name
Lipoarabinomannan carrier protein LprG (27 kDa lipoprotein) (Antigen P27) (Lipoprotein LprG) (Triacylated glycolipid carrier LprG) (Triacylglyceride transfer protein LprG)
Family
LppX/LprAFG lipoprotein family
Protein Sequence
MRTPRRHCRRIAVLAAVSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
Mass
24,548 Da
Length
236 Aa

Rv1411c doesn't seem to be a targeted by any drug.


  • Tuberculosis

    Tuberculosis mtu05152

    mtu05152

    Human Diseases; Infectious disease: bacterial


Mycobacterial Metabolic Syndrome: LprG and Rv1410 Regulate Triacylglyceride Levels, Growth Rate and Virulence in Mycobacterium tuberculosis.
PLoS Pathog. 2016 Jan 11;12(1):e1005351. doi: 10.1371/journal.ppat.1005351. eCollection 2016 Jan.
Mycobacterium tuberculosis lipoprotein LprG (Rv1411c) binds triacylated glycolipid agonists of Toll-like receptor 2.
Nat Struct Mol Biol. 2010 Sep;17(9):1088-95. doi: 10.1038/nsmb.1869. Epub 2010 Aug 8.
Regulation of antigen presentation by Mycobacterium tuberculosis: a role for Toll-like receptors.
Nat Rev Microbiol. 2010 Apr;8(4):296-307. doi: 10.1038/nrmicro2321.
Mycobacterium tuberculosis lipoprotein LprG binds lipoarabinomannan and determines its cell envelope localization to control phagolysosomal fusion.
PLoS Pathog. 2014 Oct 30;10(10):e1004471. doi: 10.1371/journal.ppat.1004471. eCollection 2014 Oct.
LprG-mediated surface expression of lipoarabinomannan is essential for virulence of Mycobacterium tuberculosis.
PLoS Pathog. 2014 Sep 18;10(9):e1004376. doi: 10.1371/journal.ppat.1004376. eCollection 2014 Sep.
Specific interaction between Mycobacterium tuberculosis lipoprotein-derived peptides and target cells inhibits mycobacterial entry in vitro.
Chem Biol Drug Des. 2014 Dec;84(6):626-41. doi: 10.1111/cbdd.12365. Epub 2014 Jul 10.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
The knockout of the lprG-Rv1410 operon produces strong attenuation of Mycobacterium tuberculosis.
Microbes Infect. 2004 Feb;6(2):182-7. doi: 10.1016/j.micinf.2003.10.010.
Mycobacterium tuberculosis LprG (Rv1411c): a novel TLR-2 ligand that inhibits human macrophage class II MHC antigen processing.
J Immunol. 2004 Aug 15;173(4):2660-8. doi: 10.4049/jimmunol.173.4.2660.
Function of a mycobacterial major facilitator superfamily pump requires a membrane-associated lipoprotein.
J Bacteriol. 2008 Mar;190(5):1783-91. doi: 10.1128/JB.01046-07. Epub 2007 Dec 21.
Conserved mycobacterial lipoglycoproteins activate TLR2 but also require glycosylation for MHC class II-restricted T cell activation.
J Immunol. 2008 May 1;180(9):5833-42. doi: 10.4049/jimmunol.180.9.5833.
TLR2 and its co-receptors determine responses of macrophages and dendritic cells to lipoproteins of Mycobacterium tuberculosis.
Cell Immunol. 2009;258(1):29-37. doi: 10.1016/j.cellimm.2009.03.008. Epub 2009 Apr 11.
Mycobacterium tuberculosis lipoproteins directly regulate human memory CD4(+) T cell activation via Toll-like receptors 1 and 2.
Infect Immun. 2011 Feb;79(2):663-73. doi: 10.1128/IAI.00806-10. Epub 2010 Nov 15.
Mycobacteria release active membrane vesicles that modulate immune responses in a TLR2-dependent manner in mice.
J Clin Invest. 2011 Apr;121(4):1471-83. doi: 10.1172/JCI44261.
Role of P27 -P55 operon from Mycobacterium tuberculosis in the resistance to toxic compounds.
BMC Infect Dis. 2011 Jul 16;11:195. doi: 10.1186/1471-2334-11-195.