Rv1478
- Type
- protein_coding
- Name
- Rv1478
- Locus Name
-
Rv1478
- Product
-
Possible invasion protein
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 1668419..1669144 (+ strand)
- Gene Length
- 725 bp
- Nucleotides
-
TGCGCCACACGCGTTTTCACCCGATCAAACTGGCCTGGATCACCGCGGTGGTTGCCGGCCTGATGGTCGGTGTGGCAACGCCCGCCGATGCCGAACCCGGACAATGGGATCCCACGCTGCCGGCATTGGTCAGTGCGGGGGCGCCCGGAGATCCGCTGGCGGTAGCCAACGCGTCGTTGCAGGCCACCGCCCAGGCCACCCAGACCACGCTGGATTTGGGCAGGCAGTTCCTCGGTGGGTTGGGAATCAACCTCGGCGGCCCTGCTGCCAGCGCTCCCAGCGCCGCCACAACCGGCGCGAGCCGGATTCCGCGGGCCAACGCCCGTCAGGCCGTCGAATATGTGATTCGCCGGGCCGGGTCGCAGATGGGGGTGCCCTATTCGTGGGGTGGTGGCTCGCTTCAGGGCCCCAGCAAGGGCGTGGACTCGGGGGCCAACACTGTCGGCTTCGACTGCTCAGGTCTGGTGCGGTATGCCTTCGCCGGGGTCGGCGTGCTGATCCCGCGGTTCTCCGGTGATCAGTACAACGCCGGTCGCCACGTTCCGCCCGCTGAGGCCAAGCGCGGCGACCTGATCTTTTACGGCCCAGGCGGCGGCCAGCACGTCACCCTGTATCTGGGCAACGGCCAAATGCTGGAGGCATCCGGAAGCGCCGGCAAAGTCACGGTGAGCCCGGTGCGAAAGGCCGGAATGACGCCGTTCGTGACTAGGATCATCGAATACTGA
- Drug Resistance
- Mutations
- Function
- Peptidoglycan endopeptidase that cleaves the bond between D-glutamate and meso-diaminopimelate. Binds high-molecular weight peptidoglycan, but does not degrade it. Required for normal separation of daughter cells after cell division and cell wall integrity. Required for host cell invasion. {ECO:0000269|PubMed:16495549}.
- Family
-
Peptidase C40 family
- GO
-
- cell wall organization GO:0071555 biological_process
- cell wall GO:0005618 cellular_component
- cysteine-type peptidase activity GO:0008234 molecular_function
- InterPro
3PBI
- Name
- Peptidoglycan endopeptidase RipB (EC 3.4.-.-) (Macrophage invasion and intracellular persistence protein B) (Resuscitation-promoting factor interaction partner B) (Rpf-interacting protein B)
- Family
- Peptidase C40 family
- Protein Sequence
-
MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY
- Mass
- 24,624 Da
- Length
- 241 Aa
Summary
Rv1478 doesn't seem to be a targeted by any drug.
Rv1478 doesn't seem to be involved in any pathway.
- Peptidoglycan remodeling in Mycobacterium tuberculosis: comparison of structures and catalytic activities of RipA and RipB.
- J Mol Biol. 2011 Oct 14;413(1):247-60. doi: 10.1016/j.jmb.2011.08.014. Epub 2011 Aug 16.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- A mycobacterial operon essential for virulence in vivo and invasion and intracellular persistence in macrophages.
- Infect Immun. 2006 Mar;74(3):1757-67. doi: 10.1128/IAI.74.3.1757-1767.2006.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.