mazF4
- Type
- protein_coding
- Name
- mazF4
- Locus Name
-
Rv1495
- Product
-
Possible toxin MazF4
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 1686570..1686887 (+ strand)
- Gene Length
- 317 bp
- Nucleotides
-
TGAACGCGCCGTTGCGTGGTCAGGTCTATCGATGCGACCTCGGATACGGGGCCAAACCGTGGCTCATCGTCTCCAACAACGCCCGCAACCGTCACACCGCCGACGTGGTGGCTGTGCGCCTGACAACAACGCGGAGAACCATACCGACCTGGGTCGCCATGGGCCCCAGCGATCCATTGACCGGATACGTCAACGCGGACAACATCGAGACCCTCGGCAAAGACGAGCTCGGTGACTACCTCGGTGAGGTCACGCCGGCGACGATGAACAAAATCAACACGGCGCTCGCGACCGCGCTGGGGCTACCGTGGCCATGA
- Drug Resistance
- Mutations
- Function
- Toxic component of a type II toxin-antitoxin (TA) system. Acts as an endoribonuclease (mRNA interferase) on single-strand mRNA, cleaving between the first and second bases in the sequence UCGCU. Overexpression in M.smegmatis but not E.coli inhibits growth, this effect is neutralized by coexpression with cognate toxin MazE4. {ECO:0000269|PubMed:18485066}.; FUNCTION: Residues 29-56 inhibit ssDNA cleavage by DNA topoisomerase. This fragment does not have mRNA cleavage activity but it inhibits growth upon overexpression in M.smegmatis. {ECO:0000269|PubMed:20724443}.
- Family
-
PemK/MazF family
- GO
-
- DNA binding GO:0003677 molecular_function
- negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity GO:2000372 biological_process
- endonuclease activity GO:0004519 molecular_function
- InterPro
5XE2
- Name
- Endoribonuclease MazF4 (EC 3.1.-.-) (Toxin MazF4) (mRNA interferase MazF-mt7)
- Family
- PemK/MazF family
- Protein Sequence
-
MNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDYLGEVTPATMNKINTALATALGLPWP
- Mass
- 11,410 Da
- Length
- 105 Aa
Summary
Rv1495 doesn't seem to be a targeted by any drug.
Rv1495 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Characterization of an interplay between a Mycobacterium tuberculosis MazF homolog, Rv1495 and its sole DNA topoisomerase I.
- Nucleic Acids Res. 2010 Dec;38(22):8219-30. doi: 10.1093/nar/gkq737. Epub 2010 Aug 19.
- Characterization of mRNA interferases from Mycobacterium tuberculosis.
- J Biol Chem. 2006 Jul 7;281(27):18638-43. doi: 10.1074/jbc.M512693200. Epub 2006 Apr 12.
- The mRNA interferases, MazF-mt3 and MazF-mt7 from Mycobacterium tuberculosis target unique pentad sequences in single-stranded RNA.
- Mol Microbiol. 2008 Aug;69(3):559-69. doi: 10.1111/j.1365-2958.2008.06284.x. Epub 2008 Jun 28.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.