frdC
- Type
- protein_coding
- Name
- frdC
- Locus Name
-
Rv1554
- Product
-
Probable fumarate reductase [membrane anchor subunit] FrdC (fumarate dehydrogenase) (fumaric hydrogenase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1760175..1760555 (+ strand)
- Gene Length
- 380 bp
- Nucleotides
-
TGAGCGCCTATCGCCAGCCGGTCGAAAGATACTGGTGGGCGAGGCGGCGTTCTTACCTGCGATTCATGCTTCGCGAAATCAGTTGCATCTTCGTGGCCTGGTTTGTTCTCTATCTGATGCTGGTATTGCGCGCCGTTGGCGCGGGCGGGAATTCCTACCAGCGGTTTTTGGACTTCAGCGCCAATCCGGTTGTCGTAGTGCTGAACGTCGTCGCGTTGAGTTTCCTGCTGCTGCATGCTGTTACCTGGTTCGGATCGGCACCGCGCGCGATGGTGATTCAGGTTCGCGGCCGCCGGGTACCCGCTCGCGCGGTCCTTGCTGGGCACTACGCGGCATGGCTGGTGGTTTCGGTGATCGTTGCCTGGATGGTGCTGTCATGA
- Drug Resistance
- Mutations
- Function
- Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. {ECO:0000255|HAMAP-Rule:MF_00708}.
- Family
-
FrdC family
- GO
-
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
- Name
- Fumarate reductase subunit C
- Family
- FrdC family
- Protein Sequence
-
MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS
- Mass
- 14,449 Da
- Length
- 126 Aa
Rv1554 doesn't seem to be a targeted by any drug.
-
-
Two-component system mtu02020
mtu02020Environmental Information Processing; Signal transduction
-
-
-
Butanoate metabolism mtu00650
mtu00650PATHWAY_MAP mtu00650 Butanoate metabolism
-
-
-
Pyruvate metabolism mtu00620
mtu00620PATHWAY_MAP mtu00620 Pyruvate metabolism
-
-
-
Oxidative phosphorylation mtu00190
mtu00190PATHWAY_MAP mtu00190 Oxidative phosphorylation
-
-
-
Citrate cycle (TCA cycle) mtu00020
mtu00020Metabolism; Carbohydrate metabolism
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.