frdD
- Type
- protein_coding
- Name
- frdD
- Locus Name
-
Rv1555
- Product
-
Probable fumarate reductase [membrane anchor subunit] FrdD (fumarate dehydrogenase) (fumaric hydrogenase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 1760552..1760929 (+ strand)
- Gene Length
- 377 bp
- Nucleotides
-
TGACTCCCTCGACATCGGATGCCAGGTCGCGCCGACGCTCGGCGGAGCCCTTCCTGTGGCTGCTGTTCAGCGCCGGGGGCATGGTCACCGCCCTGGTTGCGCCCGTCCTGCTGTTGCTGTTCGGACTCGCGTTTCCGCTCGGGTGGCTCGACGCGCCCGACCACGGGCACCTACTGGCGATGGTGCGCAACCCGATCACCAAGCTTGTTGTGCTGGTCCTGGTGGTACTGGCCCTGTTCCATGCGGCGCACCGGTTCCGGTTCGTGCTCGACCATGGGCTGCAACTGGGCCGGTTCGACCGAGTGATCGCCCTGTGGTGTTACGGCATGGCCGTGTTGGGCTCGGCGACGGCGGGTTGGATGTTGCTCACTATGTAA
- Drug Resistance
- Mutations
- Function
- Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. {ECO:0000255|HAMAP-Rule:MF_00709}.
- Family
-
FrdD family
- GO
-
- fumarate metabolic process GO:0006106 biological_process
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
- Name
- Fumarate reductase subunit D
- Family
- FrdD family
- Protein Sequence
-
MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLAMVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGWMLLTM
- Mass
- 13,754 Da
- Length
- 125 Aa
Rv1555 doesn't seem to be a targeted by any drug.
-
-
Two-component system mtu02020
mtu02020Environmental Information Processing; Signal transduction
-
-
-
Butanoate metabolism mtu00650
mtu00650PATHWAY_MAP mtu00650 Butanoate metabolism
-
-
-
Pyruvate metabolism mtu00620
mtu00620PATHWAY_MAP mtu00620 Pyruvate metabolism
-
-
-
Oxidative phosphorylation mtu00190
mtu00190PATHWAY_MAP mtu00190 Oxidative phosphorylation
-
-
-
Citrate cycle (TCA cycle) mtu00020
mtu00020Metabolism; Carbohydrate metabolism
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.