TB15.3
- Type
- protein_coding
- Name
- TB15.3
- Locus Name
-
Rv1636
- Product
-
Iron-regulated universal stress protein family protein TB15.3
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 1842451..1842891 (+ strand)
- Gene Length
- 440 bp
- Nucleotides
-
TGAGCGCCTATAAGACCGTGGTGGTAGGAACCGACGGTTCGGACTCGTCGATGCGAGCGGTAGATCGCGCTGCCCAGATCGCCGGCGCAGACGCCAAGTTGATCATCGCCTCGGCATACCTACCTCAGCACGAGGACGCTCGCGCCGCCGACATTCTGAAGGACGAAAGCTACAAGGTGACGGGCACCGCCCCGATCTACGAGATCTTGCACGACGCCAAGGAACGAGCGCACAACGCCGGTGCGAAAAACGTCGAGGAACGGCCGATCGTCGGCGCCCCGGTCGACGCGTTGGTGAACCTGGCCGATGAGGAGAAGGCGGACCTGCTGGTCGTCGGCAATGTCGGTCTGAGCACGATCGCGGGTCGGCTGCTCGGATCGGTACCGGCCAATGTGTCACGCCGGGCCAAGGTCGACGTGCTGATCGTGCACACCACCTAG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Universal stress protein A family
- GO
-
- response to antibiotic GO:0046677 biological_process
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
1TQ8
- Name
- Universal stress protein Rv1636 (USP Rv1636)
- Family
- Universal stress protein A family
- Protein Sequence
-
MSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPQHEDARAADILKDESYKVTGTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVNLADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT
- Mass
- 15,312 Da
- Length
- 146 Aa
Summary
Rv1636 doesn't seem to be a targeted by any drug.
Rv1636 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.