rpmI
- Type
- protein_coding
- Name
- rpmI
- Locus Name
-
Rv1642
- Product
-
50S ribosomal protein L35 RpmI
- Functional Category
-
Information pathways
- Location
- 1852928..1853122 (+ strand)
- Gene Length
- 194 bp
- Nucleotides
-
TGCCCAAGGCCAAGACCCACAGCGGGGCCTCGAAGCGGTTCCGGCGCACCGGTACCGGCAAGATCGTCCGGCAGAAGGCCAACCGTCGGCACCTGCTCGAGCACAAGCCGAGCACCCGCACCAGGCGCCTGGACGGCCGCACCGTGGTGGCAGCCAACGACACCAAACGGGTCACGTCGTTGCTGAACGGCTGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Bacterial ribosomal protein bL35 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L35
- Family
- Bacterial ribosomal protein bL35 family
- Protein Sequence
-
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTSLLNG
- Mass
- 7,220 Da
- Length
- 64 Aa
Summary
Rv1642 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.