rplT
- Type
- protein_coding
- Name
- rplT
- Locus Name
-
Rv1643
- Product
-
50S ribosomal protein L20 RplT
- Functional Category
-
Information pathways
- Location
- 1853184..1853573 (+ strand)
- Gene Length
- 389 bp
- Nucleotides
-
TGGCACGCGTAAAGCGGGCGGTCAACGCCCACAAGAAGCGGCGCAGCATCCTGAAGGCATCGCGAGGCTATCGCGGCCAGCGATCGCGGCTTTACCGCAAAGCCAAAGAGCAGCAGCTGCATTCACTGAACTACGCCTACCGTGACCGCCGGGCGCGTAAGGGCGAGTTCCGCAAGTTGTGGATCGCACGGATCAACGCGGCTGCGCGCCTCAACGACATCACCTACAACCGGCTTATCCAGGGGCTGAAGGCCGCCGGCGTCGAGGTGGACCGGAAAAACCTCGCCGACATTGCGATCAGCGACCCGGCGGCGTTCACCGCGCTGGTCGACGTCGCCCGGGCGGCACTGCCCGAAGACGTCAACGCCCCCTCCGGGGAGGCCGCCTGA
- Drug Resistance
- Mutations
- Function
- Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity). {ECO:0000250}.
- Family
-
Bacterial ribosomal protein bL20 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- plasma membrane GO:0005886 cellular_component
- ribosomal large subunit assembly GO:0000027 biological_process
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L20
- Family
- Bacterial ribosomal protein bL20 family
- Protein Sequence
-
MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKLWIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPEDVNAPSGEAA
- Mass
- 14,527 Da
- Length
- 129 Aa
Summary
Rv1643 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.