argR
- Type
- protein_coding
- Name
- argR
- Locus Name
-
Rv1657
- Product
-
Probable arginine repressor ArgR (AHRC)
- Functional Category
-
Regulatory proteins
- Location
- 1870842..1871354 (+ strand)
- Gene Length
- 512 bp
- Nucleotides
-
TGAGCCGCGCCAAGGCCGCGCCCGTTGCGGGGCCCGAGGTCGCCGCAAACCGCGCCGGCCGCCAGGCGCGCATCGTGGCGATCCTGTCGTCGGCGCAGGTGCGCAGCCAAAACGAACTGGCGGCGCTGCTGGCCGCCGAGGGCATCGAGGTCACCCAAGCCACACTGTCACGCGATCTGGAAGAGCTCGGCGCGGTGAAACTGCGCGGCGCGGACGGCGGCACCGGCATCTACGTGGTGCCCGAGGACGGCAGCCCGGTGCGCGGCGTCTCGGGCGGTACCGACCGGATGGCGCGGCTGCTCGGTGAGCTGCTGGTGTCGACCGACGACAGCGGCAACCTCGCGGTGTTGCGCACCCCGCCGGGCGCGGCGCACTACCTGGCCAGCGCCATCGACCGCGCGGCCCTGCCCCAGGTCGTCGGCACCATCGCCGGTGATGACACCATCCTGGTGGTGGCCCGCGAGCCGACGACCGGCGCGCAACTGGCCGGCATGTTCGAGAACCTTCGGTAA
- Drug Resistance
- Mutations
- Function
- Regulates arginine biosynthesis genes. {ECO:0000250}.
- Family
-
ArgR family
- GO
-
- arginine binding GO:0034618 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA binding GO:0003677 molecular_function
- cytoplasm GO:0005737 cellular_component
- protein complex oligomerization GO:0051259 biological_process
- arginine biosynthetic process GO:0006526 biological_process
- InterPro
2ZFZ
- Name
- Arginine repressor
- Family
- ArgR family
- Protein Sequence
-
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
- Mass
- 17,350 Da
- Length
- 170 Aa
Summary
Rv1657 doesn't seem to be a targeted by any drug.
Rv1657 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.