Rv1734c
- Type
- protein_coding
- Name
- Rv1734c
- Locus Name
-
Rv1734c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 1960774..1961016 (- strand)
- Gene Length
- 242 bp
- Nucleotides
-
ATGACCAACGTCGGTGACCAGGGGGTTGACGCGGTCTTCGGGGTGATCTACCCACCTCAGGTCGCGCTGGTCAGTTTCGGCAAGCCGGCACAACGAGTTTGCGCCGTCGACGGCGCGATCCACGTCATGACGACCGTGCTGGCTACGCTGCCCGCTGACCACGGCTGCAGCGATGACCATCGCGGCGCGCTGTTCTTCCTGTCGATCAACGAGCTGACGCGGTGCGCCGCAGTAACAGGATG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
2-oxoacid dehydrogenase family
- GO
-
- transferase activity, transferring acyl groups GO:0016746 molecular_function
- InterPro
Summary
- Name
- Uncharacterized protein Rv1734c
- Family
- 2-oxoacid dehydrogenase family
- Protein Sequence
-
MTNVGDQGVDAVFGVIYPPQVALVSFGKPAQRVCAVDGAIHVMTTVLATLPADHGCSDDHRGALFFLSINELTRCAAVTG
- Mass
- 8,315 Da
- Length
- 80 Aa
Rv1734c doesn't seem to be a targeted by any drug.
Rv1734c doesn't seem to be involved in any pathway.
- Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.
- J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
- Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
- J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
- Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.
- Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.