Rv1738
- Type
- protein_coding
- Name
- Rv1738
- Locus Name
-
Rv1738
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 1965657..1965941 (+ strand)
- Gene Length
- 284 bp
- Nucleotides
-
TGTGCGGCGACCAGTCGGATCACGTGCTGCAGCACTGGACCGTCGACATATCGATCGACGAACACGAAGGATTGACTCGGGCGAAGGCACGGCTGCGTTGGCGGGAAAAGGAATTGGTGGGTGTTGGCCTGGCAAGGCTCAATCCGGCCGACCGCAACGTCCCCGAGATCGGCGATGAACTCTCGGTCGCCCGAGCCTTGTCCGACTTGGGGAAGCGAATGTTGAAGGTGTCGACCCACGACATCGAAGCTGTTACCCATCAGCCGGCGCGATTGTTGTATTGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cytosol GO:0005829 cellular_component
- response to host immune response GO:0052572 biological_process
- plasma membrane GO:0005886 cellular_component
- InterPro
4WPY
- Name
- Uncharacterized protein Rv1738
- Family
- Unknown
- Protein Sequence
-
MCGDQSDHVLQHWTVDISIDEHEGLTRAKARLRWREKELVGVGLARLNPADRNVPEIGDELSVARALSDLGKRMLKVSTHDIEAVTHQPARLLY
- Mass
- 10,606 Da
- Length
- 94 Aa
Summary
Rv1738 doesn't seem to be a targeted by any drug.
Rv1738 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.
- J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
- Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection.
- Cell Host Microbe. 2008 May 15;3(5):323-30. doi: 10.1016/j.chom.2008.03.007.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
- J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
- Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.
- Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.