Rv1767
- Type
- protein_coding
- Name
- Rv1767
- Locus Name
-
Rv1767
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2000074..2000433 (+ strand)
- Gene Length
- 359 bp
- Nucleotides
-
TGTCGGACCAGCCACGTCATCACCAGGTCCTCGACGACCTGCTGCCCCAACACCGCGCTCTACGTCACCAGATTCCCCAGGTGTACCAGCGATTTGTAGCCCTGGGCGACGCCGCGCTTACCGACGGCGCTCTCAGCCGCAAGGTCAAGGAGCTTGTGGCGCTGGCGATCGCGGTTGTGCAGGGGTGCGATGGCTGCGTCGCATCACACGCCCAAGCCGCGGTACGGGCCGGCGCTACAGCGCAAGAAGCCGCTGAGGCCATCGGGGTCACCATCTTGATGCACGGTGGACCGGCCACCATCCACGGTGCTCGTGCCTACGCGGCATTTTGCGAATTCGCTGACACAACGCCGTCCTAG
- Drug Resistance
- Mutations
- Function
- Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity. {ECO:0000256|SAAS:SAAS00088543}.
- Family
-
AhpD family
- GO
-
- peroxiredoxin activity GO:0051920 molecular_function
- peroxidase activity GO:0004601 molecular_function
- InterPro
Summary
- Name
- Alkyl hydroperoxide reductase AhpD (EC 1.11.1.15)
- Family
- AhpD family
- Protein Sequence
-
MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVVQGCDGCVASHAQAAVRAGATAQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS
- Mass
- 12,491 Da
- Length
- 119 Aa
Rv1767 doesn't seem to be a targeted by any drug.
Rv1767 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.