esxN
- Type
- protein_coding
- Name
- esxN
- Locus Name
-
Rv1793
- Product
-
Putative ESAT-6 like protein EsxN (ESAT-6 like protein 5)
- Functional Category
-
Cell wall and cell processes
- Location
- 2030694..2030978 (+ strand)
- Gene Length
- 284 bp
- Nucleotides
-
TGACGATTAATTACCAGTTCGGGGACGTCGACGCTCATGGCGCCATGATCCGCGCTCAGGCGGCGTCGCTTGAGGCGGAGCATCAGGCCATCGTTCGTGATGTGTTGGCCGCGGGTGACTTTTGGGGCGGCGCCGGTTCGGTGGCTTGCCAGGAGTTCATTACCCAGTTGGGCCGTAACTTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAACAACATGGCGCAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTAA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
WXG100 family, ESAT-6 subfamily
- GO
-
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
Summary
- Name
- ESAT-6-like protein EsxN
- Family
- WXG100 family, ESAT-6 subfamily
- Protein Sequence
-
MTINYQFGDVDAHGAMIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
- Mass
- 9,942 Da
- Length
- 94 Aa
Rv1793 doesn't seem to be a targeted by any drug.
Rv1793 doesn't seem to be involved in any pathway.
- Disruption of the ESX-5 system of Mycobacterium tuberculosis causes loss of PPE protein secretion, reduction of cell wall integrity and strong attenuation.
- Mol Microbiol. 2012 Mar;83(6):1195-209. doi: 10.1111/j.1365-2958.2012.08001.x. Epub 2012 Feb 20.
- Composition of the type VII secretion system membrane complex.
- Mol Microbiol. 2012 Oct;86(2):472-84. doi: 10.1111/j.1365-2958.2012.08206.x. Epub 2012 Aug 27.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Systematic genetic nomenclature for type VII secretion systems.
- PLoS Pathog. 2009 Oct;5(10):e1000507. doi: 10.1371/journal.ppat.1000507. Epub 2009 Oct 30.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.