PE_PGRS33



Type
protein_coding
Name
PE_PGRS33
Locus Name

Rv1818c

Product

PE-PGRS family protein PE_PGRS33

Functional Category

Pe/ppe

Location
2061178..2062674 (- strand)
Gene Length
1496 bp
Nucleotides
ATGTCATTTGTGGTCACGATCCCGGAGGCGCTAGCGGCGGTGGCGACCGATTTGGCGGGTATCGGGTCGACGATCGGCACCGCCAACGCGGCCGCCGCGGTCCCGACCACGACGGTGTTGGCCGCCGCCGCCGATGAGGTGTCGGCGGCGATGGCGGCATTGTTCTCCGGACACGCCCAGGCCTATCAGGCGCTGAGCGCCCAGGCGGCGCTGTTTCACGAGCAGTTCGTGCGGGCGCTCACCGCCGGGGCGGGCTCGTATGCGGCCGCCGAGGCCGCCAGCGCGGCCCCGCTAGAGGGTGTGCTCGACGTGATCAACGCCCCCGCCCTGGCGCTGTTGGGGCGCCCACTGATCGGTAACGGAGCCAACGGGGCCCCGGGGACCGGGGCAAACGGCGGCGACGGCGGAATCTTGATCGGCAACGGCGGGGCCGGCGGCTCCGGCGCGGCCGGCATGCCCGGGGGCAACGGCGGAGCCGCTGGCCTGTTCGGCAACGGCGGGGCCGGCGGCGCCGGGGGGAACGTAGCGTCCGGCACCGCAGGGTTCGGCGGGGCCGGCGGGGCCGGCGGGCTGCTCTACGGCGCCGGCGGGGCCGGCGGCGCCGGCGGACGCGCCGGTGGTGGGGTGGGCGGTATTGGTGGGGCCGGCGGGGCCGGCGGCAATGGCGGGCTGCTGTTCGGCGCCGGCGGGGCCGGCGGCGTCGGCGGACTCGCGGCTGACGCCGGTGACGGCGGGGCCGGCGGAGACGGCGGGTTGTTCTTCGGCGTGGGCGGTGCCGGCGGGGCCGGCGGCACCGGCACTAATGTCACCGGCGGTGCCGGCGGGGCCGGCGGCAATGGCGGGCTCCTGTTCGGCGCCGGCGGGGTGGGCGGTGTTGGCGGTGACGGTGTGGCATTCCTGGGCACCGCCCCCGGCGGGCCCGGTGGTGCCGGCGGGGCCGGTGGGCTGTTCGGCGTCGGTGGGGCCGGCGGCGCCGGCGGAATCGGATTGGTCGGGAACGGCGGTGCCGGGGGGTCCGGCGGGTCCGCCCTGCTCTGGGGCGACGGCGGTGCCGGCGGCGCGGGTGGGGTCGGGTCCACTACCGGCGGTGCCGGCGGGGCGGGCGGCAACGCCGGCCTGCTGGTAGGCGCCGGCGGGGCCGGCGGCGCCGGCGCACTCGGCGGTGGCGCTACCGGGGTGGGCGGCGCCGGCGGAAACGGCGGCACTGCGGGCCTGCTGTTTGGTGCCGGCGGCGCCGGCGGATTCGGCTTCGGCGGTGCCGGGGGCGCCGGTGGGCTCGGCGGCAAAGCCGGGCTGATCGGCGACGGCGGTGACGGCGGCGCCGGAGGAAACGGCACCGGTGCCAAGGGCGGTGACGGCGGCGCTGGCGGCGGTGCCATCCTGGTCGGCAACGGCGGCAACGGCGGCAACGCCGGGAGTGGCACACCTAACGGCAGCGCGGGCACCGGCGGTGCCGGCGGGCTGTTGGGTAAGAACGGGATGAACGGGTTACCGTA
Drug Resistance

Check for drug resistance association at TBDREAMDB

Mutations

Check for mutants available at TARGET


Function
Induces TNF-alpha release through human Toll-like receptor 2 (TLR2) signaling pathway, leading to macrophage apoptosis (PubMed:17095513, PubMed:17223373, PubMed:24106104). The signaling pathway involves TLR2-dependent activation of the mitogen-activated protein kinase kinase kinase 5 (ASK1), which activates the p38 and JNK MAPKs, leading to enhanced expression of TNF-alpha and tumor necrosis factor receptor superfamily member 1A (TNFRI) genes. Signals are amplified through classical caspase 8-dependent mitochondrial release of cytochrome c, leading to the activation of caspases 9 and 3 (PubMed:17095513). Mediates Ca(2+)-dependent up-regulation of the anti-inflammatory cytokine IL-10 (PubMed:27483162). Mediates entry into macrophages in a TLR2-dependent mechanism and activates the TLR2-dependent pro-adhesive pathway (PubMed:26978522). {ECO:0000269|PubMed:17095513, ECO:0000269|PubMed:17223373, ECO:0000269|PubMed:24106104, ECO:0000269|PubMed:26978522, ECO:0000269|PubMed:27483162}.
Family

Mycobacterial PE family, PGRS subfamily

GO
InterPro

UniProt
P9WIF5
GenBank
Rv1818c
EnsemblBacteria
Rv1818c
Mycobrowser
Rv1818c


Summary
Name
PE-PGRS family protein PE_PGRS33
Family
Mycobacterial PE family, PGRS subfamily
Protein Sequence
MSFVVTIPEALAAVATDLAGIGSTIGTANAAAAVPTTTVLAAAADEVSAAMAALFSGHAQAYQALSAQAALFHEQFVRALTAGAGSYAAAEAASAAPLEGVLDVINAPALALLGRPLIGNGANGAPGTGANGGDGGILIGNGGAGGSGAAGMPGGNGGAAGLFGNGGAGGAGGNVASGTAGFGGAGGAGGLLYGAGGAGGAGGRAGGGVGGIGGAGGAGGNGGLLFGAGGAGGVGGLAADAGDGGAGGDGGLFFGVGGAGGAGGTGTNVTGGAGGAGGNGGLLFGAGGVGGVGGDGVAFLGTAPGGPGGAGGAGGLFGVGGAGGAGGIGLVGNGGAGGSGGSALLWGDGGAGGAGGVGSTTGGAGGAGGNAGLLVGAGGAGGAGALGGGATGVGGAGGNGGTAGLLFGAGGAGGFGFGGAGGAGGLGGKAGLIGDGGDGGAGGNGTGAKGGDGGAGGGAILVGNGGNGGNAGSGTPNGSAGTGGAGGLLGKNGMNGLP
Mass
40,755 Da
Length
498 Aa

Rv1818c doesn't seem to be a targeted by any drug.


Rv1818c doesn't seem to be involved in any pathway.


PE_PGRS33 Contributes to Mycobacterium tuberculosis Entry in Macrophages through Interaction with TLR2.
PLoS One. 2016 Mar 15;11(3):e0150800. doi: 10.1371/journal.pone.0150800. eCollection 2016.
The PE_PGRS Proteins of Mycobacterium tuberculosis Are Ca(2+) Binding Mediators of Host-Pathogen Interaction.
Biochemistry. 2016 Aug 23;55(33):4675-87. doi: 10.1021/acs.biochem.6b00289. Epub 2016 Aug 11.
A PE_PGRS33 protein of Mycobacterium tuberculosis: an ideal target for future tuberculosis vaccine design.
Expert Rev Vaccines. 2015 May;14(5):699-711. doi: 10.1586/14760584.2015.1015995. Epub 2015 Feb 19.
The PGRS Domain from PE_PGRS33 of Mycobacterium tuberculosis is Target of Humoral Immune Response in Mice and Humans.
Front Immunol. 2014 May 27;5:236. doi: 10.3389/fimmu.2014.00236. eCollection 2014.
Functional dissection of protein domains involved in the immunomodulatory properties of PE_PGRS33 of Mycobacterium tuberculosis.
Pathog Dis. 2013 Dec;69(3):232-9. doi: 10.1111/2049-632X.12096. Epub 2013 Oct 7.
Functional dissection of the PE domain responsible for translocation of PE_PGRS33 across the mycobacterial cell wall.
PLoS One. 2011;6(11):e27713. doi: 10.1371/journal.pone.0027713. Epub 2011 Nov 16.
Induction of cell death after localization to the host cell mitochondria by the Mycobacterium tuberculosis PE_PGRS33 protein.
Microbiology. 2011 Mar;157(Pt 3):793-804. doi: 10.1099/mic.0.041996-0. Epub 2010 Nov 16.
Expression of Mycobacterium tuberculosis pe_pgrs33 is repressed during stationary phase and stress conditions, and its transcription is mediated by sigma factor A.
Microb Pathog. 2009 Mar;46(3):119-27. doi: 10.1016/j.micpath.2008.11.003. Epub 2008 Nov 27.
A comparative study of host response to three Mycobacterium tuberculosis PE_PGRS proteins.
Microbiology. 2008 Nov;154(Pt 11):3469-79. doi: 10.1099/mic.0.2008/019968-0.
PE is a functional domain responsible for protein translocation and localization on mycobacterial cell wall.
Mol Microbiol. 2007 Dec;66(6):1536-47. doi: 10.1111/j.1365-2958.2007.06023.x. Epub 2007 Nov 19.
Apoptosis triggered by Rv1818c, a PE family gene from Mycobacterium tuberculosis is regulated by mitochondrial intermediates in T cells.
Microbes Infect. 2007 Mar;9(3):271-81. doi: 10.1016/j.micinf.2006.11.013. Epub 2006 Dec 20.
Execution of macrophage apoptosis by PE_PGRS33 of Mycobacterium tuberculosis is mediated by Toll-like receptor 2-dependent release of tumor necrosis factor-alpha.
J Biol Chem. 2007 Jan 12;282(2):1039-50. doi: 10.1074/jbc.M604379200. Epub 2006 Nov 9.
Differential B-cell responses are induced by Mycobacterium tuberculosis PE antigens Rv1169c, Rv0978c, and Rv1818c.
Clin Vaccine Immunol. 2007 Oct;14(10):1334-41. doi: 10.1128/CVI.00181-07. Epub 2007 Aug 8.
Variable expression patterns of Mycobacterium tuberculosis PE_PGRS genes: evidence that PE_PGRS16 and PE_PGRS26 are inversely regulated in vivo.
J Bacteriol. 2006 May;188(10):3721-5. doi: 10.1128/JB.188.10.3721-3725.2006.
Rv1818c-encoded PE_PGRS protein of Mycobacterium tuberculosis is surface exposed and influences bacterial cell structure.
Mol Microbiol. 2004 May;52(3):725-33. doi: 10.1111/j.1365-2958.2004.04007.x.
Are the PE-PGRS proteins of Mycobacterium tuberculosis variable surface antigens?
Mol Microbiol. 2002 Apr;44(1):9-19.
Comparative immune response to PE and PE_PGRS antigens of Mycobacterium tuberculosis.
Infect Immun. 2001 Sep;69(9):5606-11. doi: 10.1128/iai.69.9.5606-5611.2001.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.