Rv1824
- Type
- protein_coding
- Name
- Rv1824
- Locus Name
-
Rv1824
- Product
-
Conserved hypothetical membrane protein
- Functional Category
-
Cell wall and cell processes
- Location
- 2070654..2071019 (+ strand)
- Gene Length
- 365 bp
- Nucleotides
-
TGGGGAGCGATACGGCCTGGAGTCCGGCGCGCATGATCGGGATCGCGGCGCTCGCCGTTGGAATCGTGCTGGGTTTGGTTTTCCATCCCGGCGTGCCAGAGGTCATCCAGCCGTATCTGCCGATCGCGGTGGTCGCCGCGCTCGACGCGGTGTTCGGTGGCTTGCGCGCCTATCTCGAGCGGATCTTTGACCCGAAGGTCTTCGTGGTTTCGTTCGTGTTCAACGTTTTGGTGGCTGCCCTAATCGTCTATGTCGGTGACCAACTGGGCGTCGGCACACAGTTGTCCACCGCGATCATCGTCGTGCTGGGCATCCGCATCTTCGGCAACACCGCGGCCTTGCGGCGGCGGTTGTTCGGAGCGTGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Sbp family
- GO
-
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Uncharacterized protein Rv1824
- Family
- Sbp family
- Protein Sequence
-
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLERIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFGA
- Mass
- 12,750 Da
- Length
- 121 Aa
Rv1824 doesn't seem to be a targeted by any drug.
Rv1824 doesn't seem to be involved in any pathway.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.