blaI
- Type
- protein_coding
- Name
- blaI
- Locus Name
-
Rv1846c
- Product
-
Transcriptional repressor BlaI
- Functional Category
-
Regulatory proteins
- Location
- 2096183..2096599 (- strand)
- Gene Length
- 416 bp
- Nucleotides
-
ATGGCCAAGCTGACACGGTTGGGGGATTTGGAACGCGCGGTCATGGACCATTTGTGGTCCAGGACGGAACCCCAAACCGTTCGCCAAGTCCACGAAGCGTTGTCGGCGCGCCGCGACCTTGCCTACACGACGGTGATGACCGTGCTGCAACGGTTGGCAAAGAAGAACCTCGTGCTGCAGATCCGCGACGATCGAGCCCACCGCTACGCTCCCGTGCACGGCCGCGACGAATTGGTCGCCGGGCTGATGGTCGATGCATTGGCTCAGGCCGAGGACTCCGGCAGCAGGCAAGCCGCGCTGGTGCACTTCGTCGAGCGAGTCGGTGCCGACGAGGCGGATGCGCTACGACGTGCGCTCGCCGAATTGGAAGCCGGTCATGGCAATCGGCCACCGGCTGGCGCGGCAACGGAGACTTG
- Drug Resistance
- Mutations
- Function
- Transcription regulator that binds to an inverted DNA repeat with the consensus sequence 5'-TAC[GT]AC-NNNNN-GT[AC]GTA-3' and regulates genes involved in antibiotic transport, detoxification and cell wall function. Also regulates its own transcription. Binds DNA as a dimer. {ECO:0000269|PubMed:19154333}.
- Family
-
BlaI transcriptional regulatory family
- GO
-
- response to antibiotic GO:0046677 biological_process
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- regulation of transcription, DNA-templated GO:0006355 biological_process
- cytoplasm GO:0005737 cellular_component
- InterPro
2G9W
- Name
- Transcriptional regulator BlaI
- Family
- BlaI transcriptional regulatory family
- Protein Sequence
-
MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQIRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEAGHGNRPPAGAATET
- Mass
- 15,211 Da
- Length
- 138 Aa
Summary
Rv1846c doesn't seem to be a targeted by any drug.
Rv1846c doesn't seem to be involved in any pathway.
- Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis.
- Mol Microbiol. 2009 Mar;71(5):1102-16. doi: 10.1111/j.1365-2958.2008.06583.x. Epub 2009 Jan 16.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.