bfrA
- Type
- protein_coding
- Name
- bfrA
- Locus Name
-
Rv1876
- Product
-
Probable bacterioferritin BfrA
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2125340..2125819 (+ strand)
- Gene Length
- 479 bp
- Nucleotides
-
TGCAAGGTGATCCCGATGTTCTGCGCCTGCTCAACGAACAATTGACCAGCGAGCTCACCGCTATCAACCAATACTTTCTGCACTCCAAGATGCAGGACAACTGGGGTTTTACCGAGCTGGCGGCCCACACCCGCGCGGAGTCGTTCGACGAAATGCGGCACGCCGAGGAAATCACCGATCGCATCTTGTTGCTGGATGGTTTGCCGAACTACCAGCGCATCGGTTCGTTGCGTATCGGCCAGACGCTCCGCGAGCAATTTGAGGCCGATCTGGCGATCGAATACGACGTGTTGAATCGTCTCAAGCCAGGAATCGTCATGTGCCGGGAGAAACAGGACACCACCAGCGCCGTACTGCTGGAGAAAATCGTTGCCGACGAGGAAGAACACATCGACTACTTGGAAACGCAGCTGGAGCTGATGGACAAGCTAGGAGAGGAGCTTTACTCGGCGCAGTGCGTCTCTCGCCCACCGACCTGA
- Drug Resistance
- Mutations
- Function
- Iron-storage protein, whose ferroxidase center binds Fe(2+) ions, oxidizes them by dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the protein complex. {ECO:0000250}.
- Family
-
Bacterioferritin family
- GO
-
- response to iron ion GO:0010039 biological_process
- extracellular region GO:0005576 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- ferric iron binding GO:0008199 molecular_function
- siderophore-dependent iron import into cell GO:0033214 biological_process
- ferroxidase activity GO:0004322 molecular_function
- InterPro
2WTL
- Name
- Bacterioferritin (BFR) (EC 1.16.3.1)
- Family
- Bacterioferritin family
- Protein Sequence
-
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT
- Mass
- 18,341 Da
- Length
- 159 Aa
Summary
Rv1876 doesn't seem to be a targeted by any drug.
-
-
Mtb iron assimilation by chelation R-HSA-1222449
Homo sapiensR-HSA-1222449
-
-
-
Porphyrin and chlorophyll metabolism mtu00860
mtu00860PATHWAY_MAP mtu00860 Porphyrin and chlorophyll metabolism
-
- Crystal structure of Bfr A from Mycobacterium tuberculosis: incorporation of selenomethionine results in cleavage and demetallation of haem.
- PLoS One. 2009 Nov 25;4(11):e8028. doi: 10.1371/journal.pone.0008028.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Cloning, expression, purification, crystallization and preliminary X-ray crystallographic analysis of bacterioferritin A from Mycobacterium tuberculosis.
- Acta Crystallogr Sect F Struct Biol Cryst Commun. 2008 May 1;64(Pt 5):398-401. doi: 10.1107/S1744309108007240. Epub 2008 Apr 24.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.