fbpB
- Type
- protein_coding
- Name
- fbpB
- Locus Name
-
Rv1886c
- Product
-
Secreted antigen 85-B FbpB (85B) (antigen 85 complex B) (mycolyl transferase 85B) (fibronectin-binding protein B) (extracellular alpha-antigen)
- Functional Category
-
Lipid metabolism
- Location
- 2134890..2135867 (- strand)
- Gene Length
- 977 bp
- Nucleotides
-
ATGACAGACGTGAGCCGAAAGATTCGAGCTTGGGGACGCCGATTGATGATCGGCACGGCAGCGGCTGTAGTCCTTCCGGGCCTGGTGGGGCTTGCCGGCGGAGCGGCAACCGCGGGCGCGTTCTCCCGGCCGGGGCTGCCGGTCGAGTACCTGCAGGTGCCGTCGCCGTCGATGGGCCGCGACATCAAGGTTCAGTTCCAGAGCGGTGGGAACAACTCACCTGCGGTTTATCTGCTCGACGGCCTGCGCGCCCAAGACGACTACAACGGCTGGGATATCAACACCCCGGCGTTCGAGTGGTACTACCAGTCGGGACTGTCGATAGTCATGCCGGTCGGCGGGCAGTCCAGCTTCTACAGCGACTGGTACAGCCCGGCCTGCGGTAAGGCTGGCTGCCAGACTTACAAGTGGGAAACCTTCCTGACCAGCGAGCTGCCGCAATGGTTGTCCGCCAACAGGGCCGTGAAGCCCACCGGCAGCGCTGCAATCGGCTTGTCGATGGCCGGCTCGTCGGCAATGATCTTGGCCGCCTACCACCCCCAGCAGTTCATCTACGCCGGCTCGCTGTCGGCCCTGCTGGACCCCTCTCAGGGGATGGGGCCTAGCCTGATCGGCCTCGCGATGGGTGACGCCGGCGGTTACAAGGCCGCAGACATGTGGGGTCCCTCGAGTGACCCGGCATGGGAGCGCAACGACCCTACGCAGCAGATCCCCAAGCTGGTCGCAAACAACACCCGGCTATGGGTTTATTGCGGGAACGGCACCCCGAACGAGTTGGGCGGTGCCAACATACCCGCCGAGTTCTTGGAGAACTTCGTTCGTAGCAGCAACCTGAAGTTCCAGGATGCGTACAACGCCGCGGGCGGGCACAACGCCGTGTTCAACTTCCCGCCCAACGGCACGCACAGCTGGGAGTACTGGGGCGCTCAGCTCAACGCCATGAAGGGTGACCTGCAGAGTTCGTTAGGCGCCGGCTG
- Drug Resistance
- Mutations
- Function
- The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. {ECO:0000269|PubMed:12010501, ECO:0000269|PubMed:3141278, ECO:0000269|PubMed:9162010}.
- Family
-
Mycobacterial A85 antigen family
- GO
-
- growth of symbiont in host cell GO:0044119 biological_process
- mycolate cell wall layer assembly GO:0071769 biological_process
- positive regulation of plasminogen activation GO:0010756 biological_process
- response to antibiotic GO:0046677 biological_process
- diacylglycerol O-acyltransferase activity GO:0004144 molecular_function
- transferase activity, transferring acyl groups other than amino-acyl groups GO:0016747 molecular_function
- zymogen binding GO:0035375 molecular_function
- fibronectin binding GO:0001968 molecular_function
- plasma membrane GO:0005886 cellular_component
- response to host immune response GO:0052572 biological_process
- extracellular region GO:0005576 cellular_component
- cell wall GO:0005618 cellular_component
- regulation of growth rate GO:0040009 biological_process
- trehalose O-mycolyltransferase activity GO:0050348 molecular_function
- interaction with host via substance in symbiont surface GO:0044044 biological_process
- InterPro
1F0N
- Name
- Diacylglycerol acyltransferase/mycolyltransferase Ag85B (DGAT) (EC 2.3.1.122) (EC 2.3.1.20) (30 kDa extracellular protein) (Acyl-CoA:diacylglycerol acyltransferase) (Antigen 85 complex B) (85B) (Ag85B) (Extracellular alpha-antigen) (Fibronectin-binding protein B) (Fbps B)
- Family
- Mycobacterial A85 antigen family
- Protein Sequence
-
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
- Mass
- 34,581 Da
- Length
- 325 Aa
Summary
Rv1886c doesn't seem to be a targeted by any drug.
-
-
Arabinogalactan biosynthesis - Mycobacterium mtu00572
mtu00572Metabolism; Glycan biosynthesis and metabolism
-
-
-
Glycerolipid metabolism mtu00561
mtu00561PATHWAY_MAP mtu00561 Glycerolipid metabolism
-
- An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
- J Mol Biol. 2001 Mar 23;307(2):671-81. doi: 10.1006/jmbi.2001.4461.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis.
- Mol Microbiol. 2002 May;44(4):1109-22.
- Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis.
- Science. 1997 May 30;276(5317):1420-2. doi: 10.1126/science.276.5317.1420.
- Characterization of fibronectin-binding antigens released by Mycobacterium tuberculosis and Mycobacterium bovis BCG.
- Infect Immun. 1988 Dec;56(12):3046-51.
- Evidence for three separate genes encoding the proteins of the mycobacterial antigen 85 complex.
- Infect Immun. 1990 Jan;58(1):272-4.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Single nucleotide polymorphisms in cell wall biosynthesis-associated genes and phylogeny of Mycobacterium tuberculosis lineages.
- Infect Genet Evol. 2010 May;10(4):459-66. doi: 10.1016/j.meegid.2010.03.003. Epub 2010 Mar 16.
- Novel insights into the genetics, biochemistry, and immunocytochemistry of the 30-kilodalton major extracellular protein of Mycobacterium tuberculosis.
- Infect Immun. 1996 Aug;64(8):3038-47.
- Nucleotide sequence of the 85B-protein gene of Mycobacterium bovis BCG and Mycobacterium tuberculosis.
- DNA Seq. 1994;4(4):267-70.