Rv1897c
- Type
- protein_coding
- Name
- Rv1897c
- Locus Name
-
Rv1897c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2144451..2144882 (- strand)
- Gene Length
- 431 bp
- Nucleotides
-
GTGCGGGTTCTGGTGCAACGGGTCTCATCGGCTGCGGTGAGGGTCGATGGTCGGGTGGTCGGCGCTATCCGGCCGGACGGGCAGGGCCTGGTCGCGTTCGTCGGTGTCACCCACGGCGACGATCTCGACAAGGCGCGCCGTCTCGCCGAAAAGCTCTGGAATTTGCGGGTTCTCGCCGACGAGAAATCCGCCTCCGACATGCACGCACCGATCCTGGTAATCAGCCAGTTCACCCTCTACGCAGACACCGCGAAGGGTCGGCGACCGTCCTGGAACGCCGCGGCGCCAGGTGCGGTGGCGCAGCCCCTGATAGCAGCGTTCGCGGCAGCGCTGCGCCAGTTGGGAGCGCACGTGGAAGCCGGCGTGTTCGGTGCCCACATGCAGGTCGAACTGGTCAACGACGGTCCGGTGACCGTAATGCTGGAAGGCTG
- Drug Resistance
- Mutations
- Function
- An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging by AlaRS. Acts via tRNA-based rather than protein-based catalysis; rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. {ECO:0000255|HAMAP-Rule:MF_00518}.
- Family
-
DTD family
- GO
-
- D-amino acid catabolic process GO:0019478 biological_process
- cytoplasm GO:0005737 cellular_component
- Gly-tRNA(Ala) hydrolase activity GO:0106026 molecular_function
- D-tyrosyl-tRNA(Tyr) deacylase activity GO:0051500 molecular_function
- tRNA metabolic process GO:0006399 biological_process
- aminoacyl-tRNA editing activity GO:0002161 molecular_function
- Ser(Gly)-tRNA(Ala) hydrolase activity GO:0043908 molecular_function
- tRNA binding GO:0000049 molecular_function
- InterPro
Summary
- Name
- D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-)
- Family
- DTD family
- Protein Sequence
-
MRVLVQRVSSAAVRVDGRVVGAIRPDGQGLVAFVGVTHGDDLDKARRLAEKLWNLRVLADEKSASDMHAPILVISQFTLYADTAKGRRPSWNAAAPGAVAQPLIAAFAAALRQLGAHVEAGVFGAHMQVELVNDGPVTVMLEG
- Mass
- 15,116 Da
- Length
- 143 Aa
Rv1897c doesn't seem to be a targeted by any drug.
Rv1897c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.