furA
- Type
- protein_coding
- Name
- furA
- Locus Name
-
Rv1909c
- Product
-
Ferric uptake regulation protein FurA (fur)
- Functional Category
-
Regulatory proteins
- Location
- 2156149..2156592 (- strand)
- Gene Length
- 443 bp
- Nucleotides
-
GTGTCCTCTATACCGGACTACGCCGAACAGCTCCGGACGGCCGACCTGCGCGTGACCCGACCGCGCGTCGCCGTCCTGGAAGCAGTGAATGCGCATCCACACGCCGACACGGAAACGATTTTCGGTGCCGTGCGTTTTGCGCTGCCCGACGTATCCCGGCAAGCCGTGTACGACGTGCTGCATGCCCTGACCGCCGCGGGCTTGGTGCGAAAGATCCAACCCTCGGGCTCCGTCGCGCGCTACGAGTCCAGGGTCGGCGACAACCACCATCACATCGTCTGCCGGTCTTGCGGGGTTATCGCCGATGTCGACTGTGCTGTTGGCGAGGCACCCTGTCTGACGGCCTCGGACCATAACGGCTTCCTGTTGGACGAGGCGGAGGTCATCTACTGGGGTCTATGTCCTGATTGTTCGATATCCGACACTTCGCGATCACATCCGTG
- Drug Resistance
- Mutations
- Function
- Represses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner. {ECO:0000269|PubMed:11401695, ECO:0000269|PubMed:12949087}.
- Family
-
Fur family
- GO
-
- transcription regulatory region DNA binding GO:0044212 molecular_function
- regulation of secondary metabolite biosynthetic process GO:1900376 biological_process
- response to iron ion GO:0010039 biological_process
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- regulation of transcription, DNA-templated GO:0006355 biological_process
- cytoplasm GO:0005737 cellular_component
- zinc ion binding GO:0008270 molecular_function
- response to oxidative stress GO:0006979 biological_process
- InterPro
Summary
- Name
- Transcriptional regulator FurA
- Family
- Fur family
- Protein Sequence
-
MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP
- Mass
- 15,892 Da
- Length
- 147 Aa
Rv1909c doesn't seem to be a targeted by any drug.
Rv1909c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Mycobacterium tuberculosis FurA autoregulates its own expression.
- J Bacteriol. 2003 Sep;185(18):5357-62. doi: 10.1128/jb.185.18.5357-5362.2003.
- Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis.
- Mol Microbiol. 2001 May;40(4):879-89.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.