mpt64
- Type
- protein_coding
- Name
- mpt64
- Locus Name
-
Rv1980c
- Product
-
Immunogenic protein Mpt64 (antigen Mpt64/MPB64)
- Functional Category
-
Cell wall and cell processes
- Location
- 2223343..2224029 (- strand)
- Gene Length
- 686 bp
- Nucleotides
-
GTGCGCATCAAGATCTTCATGCTGGTCACGGCTGTCGTTTTGCTCTGTTGTTCGGGTGTGGCCACGGCCGCGCCCAAGACCTACTGCGAGGAGTTGAAAGGCACCGATACCGGCCAGGCGTGCCAGATTCAAATGTCCGACCCGGCCTACAACATCAACATCAGCCTGCCCAGTTACTACCCCGACCAGAAGTCGCTGGAAAATTACATCGCCCAGACGCGCGACAAGTTCCTCAGCGCGGCCACATCGTCCACTCCACGCGAAGCCCCCTACGAATTGAATATCACCTCGGCCACATACCAGTCCGCGATACCGCCGCGTGGTACGCAGGCCGTGGTGCTCAAGGTCTACCAGAACGCCGGCGGCACGCACCCAACGACCACGTACAAGGCCTTCGATTGGGACCAGGCCTATCGCAAGCCAATCACCTATGACACGCTGTGGCAGGCTGACACCGATCCGCTGCCAGTCGTCTTCCCCATTGTGCAAGGTGAACTGAGCAAGCAGACCGGACAACAGGTATCGATAGCGCCGAATGCCGGCTTGGACCCGGTGAATTATCAGAACTTCGCAGTCACGAACGACGGGGTGATTTTCTTCTTCAACCCGGGGGAGTTGCTGCCCGAAGCAGCCGGCCCAACCCAGGTATTGGTCCCACGTTCCGCGATCGACTCGATGCTGGCCTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cellular response to starvation GO:0009267 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- zymogen binding GO:0035375 molecular_function
- InterPro
2HHI
- Name
- Immunogenic protein MPT64 (Antigen MPT64)
- Family
- Unknown
- Protein Sequence
-
MRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
- Mass
- 24,855 Da
- Length
- 228 Aa
Summary
Rv1980c doesn't seem to be a targeted by any drug.
Rv1980c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- A family of cross-reacting proteins secreted by Mycobacterium tuberculosis.
- Scand J Immunol. 1992 Aug;36(2):307-19.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets.
- Infect Immun. 1997 Jun;65(6):2321-8.
- Cloning and B-cell-epitope mapping of MPT64 from Mycobacterium tuberculosis H37Rv.
- Infect Immun. 1994 May;62(5):2058-64.