cmtR
- Type
- protein_coding
- Name
- cmtR
- Locus Name
-
Rv1994c
- Product
-
Metal sensor transcriptional regulator CmtR (ArsR-SmtB family)
- Functional Category
-
Regulatory proteins
- Location
- 2237628..2237984 (- strand)
- Gene Length
- 356 bp
- Nucleotides
-
ATGCTGACGTGTGAGATGCGGGAATCGGCCCTGGCTCGACTCGGCCGGGCTCTGGCTGATCCGACGCGGTGCCGGATTCTGGTGGCGTTGCTGGATGGCGTTTGCTATCCCGGCCAGCTAGCTGCGCACCTCGGGTTGACCCGATCGAATGTGTCCAACCATCTGTCGTGTTTGCGGGGCTGCGGGCTGGTAGTCGCAACCTATGAGGGCCGGCAGGTTCGGTATGCGCTGGCCGACAGTCACCTGGCGCGAGCCTTGGGCGAGTTGGTCCAGGTCGTTCTCGCGGTGGATACCGACCAACCCTGTGTCGCCGAGCGCGCCGCGTCCGGGGAGGCGGTCGAGATGACAGGTAGCTG
- Drug Resistance
- Mutations
- Function
- Metal-responsive transcriptional repressor for the cmt operon. Binding of cadmium or lead causes the repressor to dissociate from the DNA. {ECO:0000269|PubMed:12939264, ECO:0000269|PubMed:15966722}.
- Family
-
Unknown
- GO
-
- cadmium ion sensor activity GO:0097063 molecular_function
- DNA binding GO:0003677 molecular_function
- lead ion binding GO:0032791 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- response to lead ion GO:0010288 biological_process
- response to cadmium ion GO:0046686 biological_process
- regulation of gene expression GO:0010468 biological_process
- cadmium ion binding GO:0046870 molecular_function
- InterPro
2JSC
- Name
- HTH-type transcriptional regulator CmtR
- Family
- Unknown
- Protein Sequence
-
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS
- Mass
- 12,495 Da
- Length
- 118 Aa
Summary
Rv1994c doesn't seem to be a targeted by any drug.
Rv1994c doesn't seem to be involved in any pathway.
- NMR structural analysis of cadmium sensing by winged helix repressor CmtR.
- J Biol Chem. 2007 Oct 12;282(41):30181-8. doi: 10.1074/jbc.M701119200. Epub 2007 Jun 27.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Structural and functional characterization of Mycobacterium tuberculosis CmtR, a PbII/CdII-sensing SmtB/ArsR metalloregulatory repressor.
- Biochemistry. 2005 Jun 28;44(25):8976-88. doi: 10.1021/bi050094v.
- A cadmium-lead-sensing ArsR-SmtB repressor with novel sensory sites. Complementary metal discrimination by NmtR AND CmtR in a common cytosol.
- J Biol Chem. 2003 Nov 7;278(45):44560-6. doi: 10.1074/jbc.M307877200. Epub 2003 Aug 25.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.