fdxA
- Type
- protein_coding
- Name
- fdxA
- Locus Name
-
Rv2007c
- Product
-
Ferredoxin FdxA
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2256084..2256428 (- strand)
- Gene Length
- 344 bp
- Nucleotides
-
GTGACCTATGTGATCGGTAGTGAGTGCGTGGATGTGATGGACAAGTCCTGTGTGCAGGAGTGTCCGGTCGACTGTATCTATGAGGGCGCCCGAATGCTCTACATCAACCCCGACGAGTGCGTGGATTGTGGTGCGTGCAAACCGGCCTGCCGCGTCGAGGCGATCTACTGGGAAGGCGATCTACCCGACGATCAACACCAGCATCTGGGGGACAACGCCGCCTTTTTCCACCAAGTCCTGCCGGGCCGAGTGGCTCCGCTGGGTTCGCCGGGTGGTGCCGCAGCGGTGGGCCCGATCGGAGTCGACACGCCTCTGGTCGCGGCTATCCCGGTGGAGTGCCCTTA
- Drug Resistance
- Mutations
- Function
- Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. {ECO:0000250}.
- Family
-
Unknown
- GO
-
- metal ion binding GO:0046872 molecular_function
- electron transfer activity GO:0009055 molecular_function
- cytosol GO:0005829 cellular_component
- response to host immune response GO:0052572 biological_process
- response to hypoxia GO:0001666 biological_process
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- 3 iron, 4 sulfur cluster binding GO:0051538 molecular_function
- response to host GO:0075136 biological_process
- InterPro
Summary
- Name
- Ferredoxin
- Family
- Unknown
- Protein Sequence
-
MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP
- Mass
- 12,064 Da
- Length
- 114 Aa
Rv2007c doesn't seem to be a targeted by any drug.
-
-
Cysteine synthesis from O-acetylserine R-MTU-936721
Mycobacterium tuberculosisR-MTU-936721
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.
- J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
- Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection.
- Cell Host Microbe. 2008 May 15;3(5):323-30. doi: 10.1016/j.chom.2008.03.007.
- Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor.
- Proc Natl Acad Sci U S A. 2007 Jul 10;104(28):11568-73. doi: 10.1073/pnas.0705054104. Epub 2007 Jul 3.
- Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
- J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
- Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.
- Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.