Rv2021c
- Type
- protein_coding
- Name
- Rv2021c
- Locus Name
-
Rv2021c
- Product
-
Transcriptional regulatory protein
- Functional Category
-
Regulatory proteins
- Location
- 2266805..2267110 (- strand)
- Gene Length
- 305 bp
- Nucleotides
-
ATGGCGATGACACTACGGGACATGGACGCCGTACGTCCCGTTAACCGGGAGGCGGTGGACCGGCACAAGGCACGAATGCGCGATGAAGTGCGGGCATTCCGGCTCCGGGAGCTGCGCGCGGCTCAGTCACTCACCCAGGTCCAGGTGGCTGCGCTGGCGCACATCCGGCAGAGCCGGGTATCCAGCATCGAGAACGGCGACATCGGCTCCGCACAGGTCAACACACTGCGCAAATACGTGTCCGCTCTTGGCGGAGAACTGGATATCACCGTCCGCCTGGGAGATGAGACATTCACCCTGGCATA
- Drug Resistance
- Mutations
- Function
- Putative antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin would be HigB2. {ECO:0000305|PubMed:24662523}.
- Family
-
Unknown
- GO
-
- DNA binding GO:0003677 molecular_function
- sequence-specific DNA binding GO:0043565 molecular_function
- InterPro
Summary
- Name
- Putative antitoxin HigA2
- Family
- Unknown
- Protein Sequence
-
MAMTLRDMDAVRPVNREAVDRHKARMRDEVRAFRLRELRAAQSLTQVQVAALAHIRQSRVSSIENGDIGSAQVNTLRKYVSALGGELDITVRLGDETFTLA
- Mass
- 11,292 Da
- Length
- 101 Aa
Rv2021c doesn't seem to be a targeted by any drug.
Rv2021c doesn't seem to be involved in any pathway.
- Multiple toxin-antitoxin systems in Mycobacterium tuberculosis.
- Toxins (Basel). 2014 Mar 6;6(3):1002-20. doi: 10.3390/toxins6031002.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Characterization and transcriptome analysis of Mycobacterium tuberculosis persisters.
- MBio. 2011 Jun 14;2(3):e00100-11. doi: 10.1128/mBio.00100-11. Print 2011.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.