Gene - combatTB X

hspX

Type: protein_coding
Name: hspX
Locus Name: Rv2031c
Product: Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen) (HSP16.3)
Functional Category: Virulence, detoxification, adaptation
Location: 2278498..2278932 (- strand)
Gene Length: 434 bp
Nucleotides: ATGGCCACCACCCTTCCCGTTCAGCGCCACCCGCGGTCCCTCTTCCCCGAGTTTTCTGAGCTGTTCGCGGCCTTCCCGTCATTCGCCGGACTCCGGCCCACCTTCGACACCCGGTTGATGCGGCTGGAAGACGAGATGAAAGAGGGGCGCTACGAGGTACGCGCGGAGCTTCCCGGGGTCGACCCCGACAAGGACGTCGACATTATGGTCCGCGATGGTCAGCTGACCATCAAGGCCGAGCGCACCGAGCAGAAGGACTTCGACGGTCGCTCGGAATTCGCGTACGGTTCCTTCGTTCGCACGGTGTCGCTGCCGGTAGGTGCTGACGAGGACGACATTAAGGCCACCTACGACAAGGGCATTCTTACTGTGTCGGTGGCGGTTTCGGAAGGGAAGCCAACCGAAAAGCACATTCAGATCCGGTCCACCAACTG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Acts as a chaperone, as it has a significant ability to suppress the thermal denaturation of alcohol dehydrogenase. Cells overexpressing this gene grow more slowly than wild-type cells, and are less susceptible to autolysis following saturation of the culture in vitro, suggesting this protein may slow down the growth rate of M.tuberculosis in culture and by extension during macrophage infection. {ECO:0000269|PubMed:8755875}.

Family

Small heat shock protein (HSP20) family

GO

response to heat GO:0009408 biological_process
cellular response to hypoxia GO:0071456 biological_process
growth of symbiont in host organelle GO:0044121 biological_process
protein autophosphorylation GO:0046777 biological_process
protein folding chaperone GO:0044183 molecular_function
response to iron ion GO:0010039 biological_process
cellular response to starvation GO:0009267 biological_process
cell wall GO:0005618 cellular_component
extracellular region GO:0005576 cellular_component
cytosol GO:0005829 cellular_component
response to host immune response GO:0052572 biological_process
negative regulation of growth GO:0045926 biological_process
plasma membrane GO:0005886 cellular_component
response to hypoxia GO:0001666 biological_process
response to nitrosative stress GO:0051409 biological_process
response to host GO:0075136 biological_process
protein folding GO:0006457 biological_process

InterPro

UniProt: P9WMK1
GenBank: Rv2031c
EnsemblBacteria: Rv2031c
Mycobrowser: Rv2031c

Summary

Name: Alpha-crystallin (Acr) (14 kDa antigen) (16 kDa antigen) (HSP 16.3) (Nox16)
Family: Small heat shock protein (HSP20) family
Protein Sequence: MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Mass: 16,227 Da
Length: 144 Aa

Rv2031c doesn't seem to be a targeted by any drug.

Rv2031c doesn't seem to be involved in any pathway.

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .: PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.: J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection.: Cell Host Microbe. 2008 May 15;3(5):323-30. doi: 10.1016/j.chom.2008.03.007.
Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor.: Proc Natl Acad Sci U S A. 2007 Jul 10;104(28):11568-73. doi: 10.1073/pnas.0705054104. Epub 2007 Jul 3.
Immunogenicity of eight dormancy regulon-encoded proteins of Mycobacterium tuberculosis in DNA-vaccinated and tuberculosis-infected mice.: Infect Immun. 2007 Feb;75(2):941-9. doi: 10.1128/IAI.01137-06. Epub 2006 Dec 4.
Deletion of the Mycobacterium tuberculosis alpha-crystallin-like hspX gene causes increased bacterial growth in vivo.: Infect Immun. 2006 Feb;74(2):861-8. doi: 10.1128/IAI.74.2.861-868.2006.
Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions.: Microbiology. 2004 Nov;150(Pt 11):3821-9. doi: 10.1099/mic.0.27284-0.
Expression of Th1-mediated immunity in mouse lungs induces a Mycobacterium tuberculosis transcription pattern characteristic of nonreplicating persistence.: Proc Natl Acad Sci U S A. 2003 Jan 7;100(1):241-6. doi: 10.1073/pnas.0136863100. Epub 2002 Dec 27.
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.: J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
Hypoxic response of Mycobacterium tuberculosis studied by metabolic labeling and proteome analysis of cellular and extracellular proteins.: J Bacteriol. 2002 Jul;184(13):3485-91. doi: 10.1128/jb.184.13.3485-3491.2002.
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.: Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.
Stationary phase-associated protein expression in Mycobacterium tuberculosis: function of the mycobacterial alpha-crystallin homolog.: J Bacteriol. 1996 Aug;178(15):4484-92. doi: 10.1128/jb.178.15.4484-4492.1996.
Response to reactive nitrogen intermediates in Mycobacterium tuberculosis: induction of the 16-kilodalton alpha-crystallin homolog by exposure to nitric oxide donors.: Infect Immun. 1999 Jan;67(1):460-5.
Characterization of the major membrane protein of virulent Mycobacterium tuberculosis.: Infect Immun. 1992 May;60(5):2066-74.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
The 14,000-molecular-weight antigen of Mycobacterium tuberculosis is related to the alpha-crystallin family of low-molecular-weight heat shock proteins.: J Bacteriol. 1992 Feb;174(4):1352-9. doi: 10.1128/jb.174.4.1352-1359.1992.