Rv2034
- Type
- protein_coding
- Name
- Rv2034
- Locus Name
-
Rv2034
- Product
-
ArsR repressor protein
- Functional Category
-
Regulatory proteins
- Location
- 2281294..2281617 (+ strand)
- Gene Length
- 323 bp
- Nucleotides
-
TGTCCACTTACAGATCACCGGATCGCGCTTGGCAGGCGCTGGCGGACGGCACTCGCCGGGCCATCGTGGAGCGGCTGGCGCACGGCCCGCTGGCCGTCGGCGAGTTGGCCCGCGACCTGCCCGTCAGCCGACCCGCGGTGTCACAGCACCTCAAAGTGCTCAAGACCGCCAGGCTGGTGTGCGACCGCCCCGCGGGAACACGCCGCGTCTACCAGCTCGACCCGACAGGCCTTGCGGCATTGCGCACCGACCTCGACCGGTTCTGGACACGCGCCCTGACTGGCTACGCGCAGCTCATCGACTCCGAAGGAGACGACACATGA
- Drug Resistance
- Mutations
- Function
- Involved in the regulation of lipid metabolism and hypoxic response. Positively regulates transcription of various genes, such as phoP, groEL2 and dosR. Negatively regulates its own transcription. Acts by binding to a specific palindromic sequence motif in promoter regions. {ECO:0000269|PubMed:21782791, ECO:0000269|PubMed:22558408}.
- Family
-
Unknown
- GO
-
- transcription regulatory region DNA binding GO:0044212 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA binding GO:0003677 molecular_function
- regulation of transcription, DNA-templated GO:0006355 biological_process
- InterPro
Summary
- Name
- HTH-type transcriptional regulator Rv2034
- Family
- Unknown
- Protein Sequence
-
MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT
- Mass
- 11,856 Da
- Length
- 107 Aa
Rv2034 doesn't seem to be a targeted by any drug.
Rv2034 doesn't seem to be involved in any pathway.
- Characterization of a novel ArsR-like regulator encoded by Rv2034 in Mycobacterium tuberculosis.
- PLoS One. 2012;7(4):e36255. doi: 10.1371/journal.pone.0036255. Epub 2012 Apr 27.
- An ArsR-like transcriptional factor recognizes a conserved sequence motif and positively regulates the expression of phoP in mycobacteria.
- Biochem Biophys Res Commun. 2011 Aug 12;411(4):726-31. doi: 10.1016/j.bbrc.2011.07.014. Epub 2011 Jul 18.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.