Rv2050
- Type
- protein_coding
- Name
- Rv2050
- Locus Name
-
Rv2050
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2307821..2308156 (+ strand)
- Gene Length
- 335 bp
- Nucleotides
-
TGGCTGATCGTGTCCTGAGGGGCAGTCGCCTCGGAGCCGTGAGCTATGAGACCGACCGCAACCACGACCTGGCGCCGCGCCAGATCGCGCGGTACCGCACCGACAACGGCGAGGAGTTCGAAGTCCCGTTCGCCGATGACGCCGAGATCCCCGGCACCTGGTTGTGCCGCAACGGCATGGAAGGCACCCTGATCGAGGGCGACCTGCCCGAGCCGAAGAAGGTTAAGCCGCCCCGGACGCACTGGGACATGCTGCTGGAGCGCCGTTCCATCGAAGAACTCGAAGAGTTACTTAAGGAGCGCCTCGAGCTCATTCGGTCACGTCGGCGCGGCTGA
- Drug Resistance
- Mutations
- Function
- Binds to RNA polymerase (RNAP), stimulating and stabilizing the formation of stable RNAP promoter complexes up to 2-fold from principal sigma factor SigA-dependent but not alternative sigma factor SigF-dependent promoters. Increases the affinity of core RNAP for SigA, increasing the transcriptional activity of RNAP. Unlike the case in M.smegmatis or S.coelicolor, has no effect on rifampicin inhibition of transcription. Has no effect on E.coli RNAP. {ECO:0000269|PubMed:22570422}.
- Family
-
RNA polymerase-binding protein RbpA family
- GO
-
- positive regulation of transcription, DNA-templated GO:0045893 biological_process
- bacterial-type RNA polymerase core enzyme binding GO:0001000 molecular_function
- bacterial-type RNA polymerase holo enzyme binding GO:0001108 molecular_function
- InterPro
2M4V
- Name
- RNA polymerase-binding protein RbpA
- Family
- RNA polymerase-binding protein RbpA family
- Protein Sequence
-
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLELIRSRRRG
- Mass
- 12,972 Da
- Length
- 111 Aa
Summary
Rv2050 doesn't seem to be a targeted by any drug.
Rv2050 doesn't seem to be involved in any pathway.
- The actinobacterial transcription factor RbpA binds to the principal sigma subunit of RNA polymerase.
- Nucleic Acids Res. 2013 Jun;41(11):5679-91. doi: 10.1093/nar/gkt277. Epub 2013 Apr 19.
- Mycobacterium tuberculosis RNA polymerase-binding protein A (RbpA) and its interactions with sigma factors.
- J Biol Chem. 2013 May 17;288(20):14438-50. doi: 10.1074/jbc.M113.459883. Epub 2013 Apr 2.
- Mycobacterium tuberculosis RbpA protein is a new type of transcriptional activator that stabilizes the sigma A-containing RNA polymerase holoenzyme.
- Nucleic Acids Res. 2012 Aug;40(14):6547-57. doi: 10.1093/nar/gks346. Epub 2012 May 8.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Isolation of conditional expression mutants in Mycobacterium tuberculosis by transposon mutagenesis.
- Tuberculosis (Edinb). 2011 Nov;91(6):569-78. doi: 10.1016/j.tube.2011.07.004. Epub 2011 Aug 12.