rpsR2
- Type
- protein_coding
- Name
- rpsR2
- Locus Name
-
Rv2055c
- Product
-
30S ribosomal protein S18 RpsR2
- Functional Category
-
Information pathways
- Location
- 2314087..2314353 (- strand)
- Gene Length
- 266 bp
- Nucleotides
-
ATGGCCGCCAAATCCGCGCGAAAGGGCCCGACGAAGGCGAAGAAAAACCTGCTCGATAGCCTCGGCGTCGAGAGCGTCGATTACAAAGACACCGCAACATTGCGGGTGTTCATCTCTGACCGAGGCAAGATTCGCTCCCGGGGAGTGACCGGCCTGACAGTCCAGCAGCAACGCCAAGTCGCCCAGGCGATCAAGAACGCCCGCGAGATGGCGCTGCTGCCCTACCCGGGCCAGGACAGGCAGCGACGCGCTGCACTGTGCCCATG
- Drug Resistance
- Mutations
- Function
- Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}.
- Family
-
Bacterial ribosomal protein bS18 family
- GO
-
- cytosolic small ribosomal subunit GO:0022627 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- small ribosomal subunit rRNA binding GO:0070181 molecular_function
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S18 2
- Family
- Bacterial ribosomal protein bS18 family
- Protein Sequence
-
MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREMALLPYPGQDRQRRAALCP
- Mass
- 9,696 Da
- Length
- 88 Aa
Rv2055c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.