rpsN2
- Type
- protein_coding
- Name
- rpsN2
- Locus Name
-
Rv2056c
- Product
-
30S ribosomal protein S14 RpsN2
- Functional Category
-
Information pathways
- Location
- 2314354..2314659 (- strand)
- Gene Length
- 305 bp
- Nucleotides
-
GTGGCCAAGAAGTCCAAGATCGTCAAGAATCAGCGGCGGGCGGCCACCGTCGCCCGTTACGCATCGCGTCGCACCGCGCTCAAAGACATCATCCGATCCCCATCGAGCGCCCCCGAACAGCGCAGTACCGCCCAGCGAGCCCTTGCCCGCCAGCCCCGCGACGCCAGTCCCGTGCGGTTACGCAACCGCGACGCCATCGACGGCCGGCCGCGCGGACATCTCCGCAAATTCGGGCTCTCCCGTGTGCGGGTCCGCCAACTGGCCCACGACGGACACCTGCCCGGTGTCCGGAAGGCCAGCTGGTA
- Drug Resistance
- Mutations
- Function
- Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site. {ECO:0000255|HAMAP-Rule:MF_00537}.
- Family
-
Universal ribosomal protein uS14 family
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- cell wall GO:0005618 cellular_component
- ribosome GO:0005840 cellular_component
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S14
- Family
- Universal ribosomal protein uS14 family
- Protein Sequence
-
MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW
- Mass
- 11,441 Da
- Length
- 101 Aa
Rv2056c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.