rpmB2
- Type
- protein_coding
- Name
- rpmB2
- Locus Name
-
Rv2058c
- Product
-
50S ribosomal protein L28 RpmB2
- Functional Category
-
Information pathways
- Location
- 2314825..2315061 (- strand)
- Gene Length
- 236 bp
- Nucleotides
-
TTGTCCGCCCACTGCCAAGTCACCGGCCGCAAGCCGGGATTTGGAAACACCGTCTCGCACTCCCATCGCCGAAGCCGTCGGCGATGGTCGCCCAACATTCAGCAACGAACGTATTACCTGCCCTCCGAGGGCCGTCGCATTCGGCTGCGGGTGTCCACGAAGGGTATAAAGGTCATCGACCGCGACGGTATCGAAGCGGTCGTGGCCCGCCTGCGTCGCCAGGGGCAGCGGATCTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Bacterial ribosomal protein bL28 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 50S ribosomal protein L28-2
- Family
- Bacterial ribosomal protein bL28 family
- Protein Sequence
-
MSAHCQVTGRKPGFGNTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVIDRDGIEAVVARLRRQGQRI
- Mass
- 9,095 Da
- Length
- 78 Aa
Rv2058c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.