Rv2061c
- Type
- protein_coding
- Name
- Rv2061c
- Locus Name
-
Rv2061c
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2316681..2317085 (- strand)
- Gene Length
- 404 bp
- Nucleotides
-
GTGACCCCTACCTTTTCTGACCTTGCCGAGGCGCAGTACCTGCTGCTGACCACCTTCACCAAGGACGGCCGGCCCAAGCCGGTTCCCATCTGGGCCGCCTTGGACACCGACCGCGGGGATCGACTGCTGGTCATCACCGAGAAGAAATCGTGGAAGGTCAAGCGGATCCGCAACACGCCGCGGGTGACGCTGGCGACCTGCACCTTGCGCGGCCGGCCGACCAGCGAGGCCGTCGAAGCCACCGCGGCCATCCTCGACGAATCCCAAACGGGCGCCGTCTACGACGCGATCGTCAAGCGCTACGGCATCCAGGGCAAGCTGTTCACCTTCGTCAGTAAGCTGCGCGGCGGCATGCGGAACAACATTGGCCTAGAGCTCAAAGTGGCCGAAAGCGAGACCGGCTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cell wall GO:0005618 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- coenzyme F420 binding GO:0070967 molecular_function
- oxidoreductase activity, acting on the CH-CH group of donors GO:0016627 molecular_function
- InterPro
Summary
- Name
- Conserved protein
- Family
- Unknown
- Protein Sequence
-
MTPTFSDLAEAQYLLLTTFTKDGRPKPVPIWAALDTDRGDRLLVITEKKSWKVKRIRNTPRVTLATCTLRGRPTSEAVEATAAILDESQTGAVYDAIVKRYGIQGKLFTFVSKLRGGMRNNIGLELKVAESETG
- Mass
- 14,814 Da
- Length
- 134 Aa
Rv2061c doesn't seem to be a targeted by any drug.
Rv2061c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.