Rv2074
- Type
- protein_coding
- Name
- Rv2074
- Locus Name
-
Rv2074
- Product
-
Possible pyridoxamine 5'-phosphate oxidase (PNP/PMP oxidase) (pyridoxinephosphate oxidase) (PNPOX) (pyridoxine 5'-phosphate oxidase)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2330993..2331406 (+ strand)
- Gene Length
- 413 bp
- Nucleotides
-
TGGCGATGGTCAACACCACTACGCGGCTTAGTGACGACGCGCTGGCGTTTCTTTCCGAACGCCATCTGGCCATGCTGACCACGCTGCGGGCGGACAACTCGCCGCACGTGGTGGCGGTAGGTTTCACCTTCGACCCCAAGACTCACATCGCGCGGGTCATCACCACCGGCGGCTCCCAAAAGGCCGTCAATGCCGACCGCAGTGGGCTTGCCGTGCTCAGCCAGGTCGACGGCGCGCGCTGGCTCTCACTGGAGGGTAGGGCGGCGGTGAACAGCGACATCGACGCCGTGCGCGACGCCGAGCTGCGCTACGCGCAGCGCTATCGCACCCCGCGTCCCAATCCACGCCGAGTGGTCATCGAGGTCCAGATTGAGCGCGTGCTGGGATCCGCGGATCTGCTCGACCGGGCCTGA
- Drug Resistance
- Mutations
- Function
- Catalyzes the F420H(2)-dependent reduction of biliverdin-IXalpha at C10 position, leading to bilirubin-IXalpha, a potent antioxidant. As biliverdin-IXalpha is produced in high amounts in macrophages infected with M.tuberculosis, its reduction by Rv2074 may play a role in protecting mycobacteria against oxidative stress, aiding the persistence of M.tuberculosis infection. {ECO:0000269|PubMed:27364382}.
- Family
-
F420H(2)-dependent biliverdin reductase family
- GO
-
- cell surface GO:0009986 cellular_component
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- protein homodimerization activity GO:0042803 molecular_function
- oxidation-reduction process GO:0055114 biological_process
- coenzyme F420 binding GO:0070967 molecular_function
- oxidoreductase activity, acting on the CH-CH group of donors GO:0016627 molecular_function
- InterPro
2ASF
- Name
- F420H(2)-dependent biliverdin reductase (F-BVR) (EC 1.3.98.-)
- Family
- F420H(2)-dependent biliverdin reductase family
- Protein Sequence
-
MAMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAAVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLDRA
- Mass
- 15,024 Da
- Length
- 137 Aa
Summary
Rv2074 doesn't seem to be a targeted by any drug.
Rv2074 doesn't seem to be involved in any pathway.
- Rv2074 is a novel F420 H2 -dependent biliverdin reductase in Mycobacterium tuberculosis.
- Protein Sci. 2016 Sep;25(9):1692-709. doi: 10.1002/pro.2975. Epub 2016 Jul 17.
- The molecular structure of Rv2074, a probable pyridoxine 5'-phosphate oxidase from Mycobacterium tuberculosis, at 1.6 angstroms resolution.
- Acta Crystallogr Sect F Struct Biol Cryst Commun. 2006 Aug 1;62(Pt 8):735-42. doi: 10.1107/S1744309106025012. Epub 2006 Jul 24.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.