tatA
- Type
- protein_coding
- Name
- tatA
- Locus Name
-
Rv2094c
- Product
-
Sec-independent protein translocase membrane-bound protein TatA
- Functional Category
-
Cell wall and cell processes
- Location
- 2353046..2353297 (- strand)
- Gene Length
- 251 bp
- Nucleotides
-
GTGGGCAGTCTGAGTCCGTGGCATTGGGCGATCCTCGCTGTCGTGGTGATCGTGTTGTTCGGTGCCAAGAAGCTCCCCGATGCGGCGCGCTCGTTGGGCAAGTCATTGCGAATCTTTAAGTCCGAGGTCCGTGAACTGCAGAACGAGAACAAAGCGGAAGCGTCTATCGAGACCCCCACGCCGGTGCAATCGCAGCGTGTCGACCCCTCAGCGGCGTCTGGTCAAGACAGCACCGAGGCTCGGCCGGCTTA
- Drug Resistance
- Mutations
- Function
- Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}.
- Family
-
TatA/E family
- GO
-
- protein secretion GO:0009306 biological_process
- integral component of plasma membrane GO:0005887 cellular_component
- protein transmembrane transporter activity GO:0008320 molecular_function
- TAT protein transport complex GO:0033281 cellular_component
- protein transport by the Tat complex GO:0043953 biological_process
- InterPro
Summary
- Name
- Sec-independent protein translocase protein TatA
- Family
- TatA/E family
- Protein Sequence
-
MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPTPVQSQRVDPSAASGQDSTEARPA
- Mass
- 8,941 Da
- Length
- 83 Aa
Rv2094c doesn't seem to be a targeted by any drug.
-
-
Bacterial secretion system mtu03070
mtu03070Environmental Information Processing; Membrane transport
-
-
-
Protein export mtu03060
mtu03060Genetic Information Processing; Folding, sorting and degradation
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence.
- J Bacteriol. 2006 Sep;188(18):6669-79. doi: 10.1128/JB.00631-06.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.