pup
- Type
- protein_coding
- Name
- pup
- Locus Name
-
Rv2111c
- Product
-
Prokaryotic ubiquitin-like protein Pup
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2370598..2370792 (- strand)
- Gene Length
- 194 bp
- Nucleotides
-
ATGGCGCAAGAGCAGACCAAGCGTGGCGGTGGCGGCGGCGATGATGACGACATCGCCGGCAGCACCGCCGCGGGCCAGGAGCGTCGCGAAAAGCTGACCGAGGAGACCGACGATCTGCTCGACGAAATCGACGACGTCCTCGAGGAGAACGCCGAGGACTTCGTCCGCGCATACGTCCAAAAGGGCGGACAGTG
- Drug Resistance
- Mutations
- Function
- Protein modifier that is covalently attached to lysine residues of substrate proteins, thereby targeting them for proteasomal degradation. The tagging system is termed pupylation. Among the identified substrates are the FabD, PanB and Mpa proteins. {ECO:0000269|PubMed:18832610, ECO:0000269|PubMed:19448618, ECO:0000269|PubMed:20233925}.
- Family
-
Prokaryotic ubiquitin-like protein family
- GO
-
- proteasomal protein catabolic process GO:0010498 biological_process
- modification-dependent protein catabolic process GO:0019941 biological_process
- proteasome binding GO:0070628 molecular_function
- protein pupylation GO:0070490 biological_process
- protein tag GO:0031386 molecular_function
- InterPro
3M91
- Name
- Prokaryotic ubiquitin-like protein Pup (Bacterial ubiquitin-like modifier)
- Family
- Prokaryotic ubiquitin-like protein family
- Protein Sequence
-
MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ
- Mass
- 6,944 Da
- Length
- 64 Aa
Summary
Rv2111c doesn't seem to be a targeted by any drug.
Rv2111c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein provides a two-part degron to Mycobacterium proteasome substrates.
- J Bacteriol. 2010 Jun;192(11):2933-5. doi: 10.1128/JB.01639-09. Epub 2010 Mar 16.
- Prokaryotic ubiquitin-like protein (Pup) is coupled to substrates via the side chain of its C-terminal glutamate.
- J Am Chem Soc. 2010 Apr 28;132(16):5610-2. doi: 10.1021/ja910546x.
- The mycobacterial Mpa-proteasome unfolds and degrades pupylated substrates by engaging Pup's N-terminus.
- EMBO J. 2010 Apr 7;29(7):1262-71. doi: 10.1038/emboj.2010.23. Epub 2010 Mar 4.
- Bacterial ubiquitin-like modifier Pup is deamidated and conjugated to substrates by distinct but homologous enzymes.
- Nat Struct Mol Biol. 2009 Jun;16(6):647-51. doi: 10.1038/nsmb.1597. Epub 2009 May 17.
- Prokaryotic ubiquitin-like protein pup is intrinsically disordered.
- J Mol Biol. 2009 Sep 11;392(1):208-17. doi: 10.1016/j.jmb.2009.07.018. Epub 2009 Jul 14.
- A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa.
- FEBS Lett. 2009 Oct 6;583(19):3151-7. doi: 10.1016/j.febslet.2009.09.020. Epub 2009 Sep 15.
- Pup, a prokaryotic ubiquitin-like protein, is an intrinsically disordered protein.
- Biochem J. 2009 Aug 13;422(2):207-15. doi: 10.1042/BJ20090738.
- Identification of substrates of the Mycobacterium tuberculosis proteasome.
- EMBO J. 2006 Nov 15;25(22):5423-32. doi: 10.1038/sj.emboj.7601405. Epub 2006 Nov 2.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Ubiquitin-like protein involved in the proteasome pathway of Mycobacterium tuberculosis.
- Science. 2008 Nov 14;322(5904):1104-7. doi: 10.1126/science.1163885. Epub 2008 Oct 2.