lppM
- Type
- protein_coding
- Name
- lppM
- Locus Name
-
Rv2171
- Product
-
Probable conserved lipoprotein LppM
- Functional Category
-
Cell wall and cell processes
- Location
- 2432951..2433634 (+ strand)
- Gene Length
- 683 bp
- Nucleotides
-
TGGCAAGGACCCGACGGCGCGGCATGCTGGCCATCGCGATGTTGCTGATGCTGGTGCCTCTGGCTACCGGATGCCTGCGGGTCCGAGCCTCGATCACCATCTCGCCGGATGACCTGGTGTCCGGGGAGATCATCGCCGCGGCCAAGCCGAAAAACAGCAAAGACACCGGCCCTGCGCTCGATGGCGATGTGCCGTTCAGCCAGAAGGTTGCGGTCTCGAACTACGACAGCGACGGCTACGTGGGGTCGCAAGCAGTGTTTTCCGATTTGACCTTTGCCGAGCTGCCCCAGTTGGCCAATATGAACTCCGACGCCGCCGGAGTGAACCTGTCACTGCGCCGAAACGGCAACATCGTGATCCTGGAAGGCCGAGCGGATCTGACATCGGTATCCGATCCCGACGCCGACGTCGAGTTGACCGTCGCCTTCCCCGCAGCAGTGACTTCCACCAACGGCGACCGCATCGAGCCCGAGGTAGTGCAGTGGAAGCTCAAGCCGGGCGTGGTGAGCACGATGAGCGCACAGGCTCGTTATACCGATCCCAACACCCGGTCGTTCACCGGAGCCGGCATCTGGCTGGGCATCGCCGCGTTCGCGGCCGCCGGTGTGGTGGCCGTGCTGGCGTGGATCGACCGGGACCGCTCCCCACGGTTGACCGCTTCGGGCGACCCGCCAACCAGCTAG
- Drug Resistance
- Mutations
- Function
- A putative lipoprotein that seems to be specialized for the initial steps of macrophage infection (PubMed:27220037). A non-acylated fragment (residues 26-185) binds phosphatidyl-myo-inositol mannosides (PIMs) (PubMed:27568926). Limits, in a TLR2-dependent fashion, bacterial uptake by host (mouse); this effect may be mediated by nonacylated fragment 26-185 (PubMed:27220037). Plays a TLR2-dependent role in host phagosome maturation arrest (PubMed:20844580, PubMed:27220037). Plays a TLR2-independent role in chemokine production during the first 24 hours of mouse infection (PubMed:27220037). {ECO:0000269|PubMed:27568926, ECO:0000305|PubMed:20844580, ECO:0000305|PubMed:27220037}.
- Family
-
Unknown
- GO
-
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- negative regulation by symbiont of host innate immune response GO:0052170 biological_process
- lipid binding GO:0008289 molecular_function
- integral component of membrane GO:0016021 cellular_component
- InterPro
-
- Unknown
2NC8
- Name
- Protein LppM (Putative lipoprotein LppM)
- Family
- Unknown
- Protein Sequence
-
MARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRSFTGAGIWLGIAAFAAAGVVAVLAWIDRDRSPRLTASGDPPTS
- Mass
- 23,846 Da
- Length
- 227 Aa
Summary
Rv2171 doesn't seem to be a targeted by any drug.
Rv2171 doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis LppM Displays an Original Structure and Domain Composition Linked to a Dual Localization.
- Structure. 2016 Oct 4;24(10):1788-1794. doi: 10.1016/j.str.2016.07.009. Epub 2016 Aug 25.
- LppM impact on the colonization of macrophages by Mycobacterium tuberculosis.
- Cell Microbiol. 2017 Jan;19(1). doi: 10.1111/cmi.12619. Epub 2016 Jul 11.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- High content phenotypic cell-based visual screen identifies Mycobacterium tuberculosis acyltrehalose-containing glycolipids involved in phagosome remodeling.
- PLoS Pathog. 2010 Sep 9;6(9):e1001100. doi: 10.1371/journal.ppat.1001100.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.