Rv2204c
- Type
- protein_coding
- Name
- Rv2204c
- Locus Name
-
Rv2204c
- Product
-
Conserved protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2468931..2469287 (- strand)
- Gene Length
- 356 bp
- Nucleotides
-
ATGACGGTGCAGAACGAGCCGAGCGCCAAGACCCACGGCGTGATCCTGACCGAAGCGGCCGCCGCCAAGGCGAAGTCGCTGTTGGACCAGGAGGGACGGGACGATCTGGCGCTGCGGATCGCGGTTCAGCCGGGGGGGTGCGCTGGATTGCGCTATAACCTTTTCTTCGACGACCGGACGCTGGATGGTGACCAAACCGCGGAGTTCGGTGGTGTCAGGTTGATCGTGGACCGGATGAGCGCGCCGTATGTGGAAGGCGCGTCGATCGATTTCGTCGACACTATTGAGAAGCAAGGCTTCACCATCGACAATCCCAACGCCACCGGCTCCTGCGCGTGCGGGGATTCGTTCAACTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
HesB/IscA family
- GO
-
- structural molecule activity GO:0005198 molecular_function
- iron ion binding GO:0005506 molecular_function
- plasma membrane GO:0005886 cellular_component
- protein maturation by [4Fe-4S] cluster transfer GO:0106035 biological_process
- 2 iron, 2 sulfur cluster binding GO:0051537 molecular_function
- 4 iron, 4 sulfur cluster binding GO:0051539 molecular_function
- iron-sulfur cluster assembly GO:0016226 biological_process
- protein maturation GO:0051604 biological_process
- InterPro
Summary
- Name
- Protein Rv2204c
- Family
- HesB/IscA family
- Protein Sequence
-
MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDQTAEFGGVRLIVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN
- Mass
- 12,544 Da
- Length
- 118 Aa
Rv2204c doesn't seem to be a targeted by any drug.
Rv2204c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Identification of acidic, low molecular mass proteins of Mycobacterium tuberculosis strain H37Rv by matrix-assisted laser desorption/ionization and electrospray ionization mass spectrometry.
- Proteomics. 2001 Apr;1(4):494-507. doi: 10.1002/1615-9861(200104)1:4<494::AID-PROT494>3.0.CO;2-4.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.