acpM
- Type
- protein_coding
- Name
- acpM
- Locus Name
-
Rv2244
- Product
-
Meromycolate extension acyl carrier protein AcpM
- Functional Category
-
Lipid metabolism
- Location
- 2517771..2518118 (+ strand)
- Gene Length
- 347 bp
- Nucleotides
-
TGCCTGTCACTCAGGAAGAAATCATTGCCGGTATCGCCGAGATCATCGAAGAGGTAACCGGTATCGAGCCGTCCGAGATCACCCCGGAGAAGTCGTTCGTCGACGACCTGGACATCGACTCGCTGTCGATGGTCGAGATCGCCGTGCAGACCGAGGACAAGTACGGCGTCAAGATCCCCGACGAGGACCTCGCCGGTCTGCGTACCGTCGGTGACGTTGTCGCCTACATCCAGAAGCTCGAGGAAGAAAACCCGGAGGCGGCTCAGGCGTTGCGCGCGAAGATTGAGTCGGAGAACCCCGATGCCGTTGCCAACGTTCAGGCGAGGCTTGAGGCCGAGTCCAAGTGA
- Drug Resistance
- Mutations
- Function
- Acyl carrier protein involved in meromycolate extension. {ECO:0000250}.
- Family
-
Acyl carrier protein (ACP) family
- GO
-
- lipid A biosynthetic process GO:0009245 biological_process
- cell wall GO:0005618 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- acyl binding GO:0000035 molecular_function
- acyl carrier activity GO:0000036 molecular_function
- acyl-CoA metabolic process GO:0006637 biological_process
- InterPro
1KLP
- Name
- Meromycolate extension acyl carrier protein (ACP)
- Family
- Acyl carrier protein (ACP) family
- Protein Sequence
-
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
- Mass
- 12,524 Da
- Length
- 115 Aa
Summary
Rv2244 doesn't seem to be a targeted by any drug.
Rv2244 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.