esxO
- Type
- protein_coding
- Name
- esxO
- Locus Name
-
Rv2346c
- Product
-
Putative ESAT-6 like protein EsxO (ESAT-6 like protein 6)
- Functional Category
-
Cell wall and cell processes
- Location
- 2625888..2626172 (- strand)
- Gene Length
- 284 bp
- Nucleotides
-
ATGACCATCAACTATCAGTTCGGTGATGTCGACGCTCATGGCGCCATGATCCGCGCTCAGGCCGGGTTGCTGGAGGCGGAGCATCAGGCCATCGTTCGTGATGTGTTGGCCGCGGGTGACTTTTGGGGCGGCGCCGGTTCGGTGGCTTGCCAGGAGTTCATCACCCAGCTGGGCCGTAACTTCCAGGTGATCTACGAGCAGGCCAACGCCCACGGGCAGAAGGTGCAGGCTGCCGGCAACAACATGGCACAAACCGACAGCGCCGTCGGCTCCAGCTGGGCCTG
- Drug Resistance
- Mutations
- Function
- Plays an important role in mycobacterial pathogenesis in the context of innate immunity. Aids host cell invasion and intracellular bacillary persistence. Increases host oxidative stress response, leading to genomic instability and decrease in macrophage viability. Also induces autophagy and modulates the immune function of macrophages. {ECO:0000269|PubMed:26786654}.
- Family
-
WXG100 family, ESAT-6 subfamily
- GO
-
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
3OGI
- Name
- ESAT-6-like protein EsxO
- Family
- WXG100 family, ESAT-6 subfamily
- Protein Sequence
-
MTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
- Mass
- 9,954 Da
- Length
- 94 Aa
Summary
Rv2346c doesn't seem to be a targeted by any drug.
Rv2346c doesn't seem to be involved in any pathway.
- Heterologous expression of mycobacterial Esx complexes in Escherichia coli for structural studies is facilitated by the use of maltose binding protein fusions.
- PLoS One. 2013 Nov 29;8(11):e81753. doi: 10.1371/journal.pone.0081753. eCollection 2013.
- Mycobacterium tuberculosis EsxO (Rv2346c) promotes bacillary survival by inducing oxidative stress mediated genomic instability in macrophages.
- Tuberculosis (Edinb). 2016 Jan;96:44-57. doi: 10.1016/j.tube.2015.11.006. Epub 2015 Nov 24.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Systematic genetic nomenclature for type VII secretion systems.
- PLoS Pathog. 2009 Oct;5(10):e1000507. doi: 10.1371/journal.ppat.1000507. Epub 2009 Oct 30.
- Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
- Proteomics. 2007 May;7(10):1702-18. doi: 10.1002/pmic.200600853.
- Comparative proteome analysis of culture supernatant proteins of Mycobacterium tuberculosis H37Rv and H37Ra.
- Microbes Infect. 2003 Aug;5(10):851-6.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.