rpsT
- Type
- protein_coding
- Name
- rpsT
- Locus Name
-
Rv2412
- Product
-
30S ribosomal protein S20 RpsT
- Functional Category
-
Information pathways
- Location
- 2710075..2710335 (+ strand)
- Gene Length
- 260 bp
- Nucleotides
-
TGGCCAACATCAAGTCGCAGCAGAAGCGCAACCGCACCAACGAGCGCGCCCGGCTGCGCAACAAGGCGGTGAAGTCCTCGCTTCGTACCGCTGTCCGTGCCTTCCGCGAAGCTGCCCATGCAGGCGACAAGGCAAAGGCCGCGGAACTGCTGGCGTCGACCAACCGCAAGCTGGACAAGGCGGCCAGCAAGGGCGTGATCCACAAAAACCAGGCCGCCAACAAGAAGTCGGCACTGGCCCAGGCGCTCAACAAGCTCTGA
- Drug Resistance
- Mutations
- Function
- Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}.
- Family
-
Bacterial ribosomal protein bS20 family
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- ribosome GO:0005840 cellular_component
- cytosol GO:0005829 cellular_component
- small ribosomal subunit rRNA binding GO:0070181 molecular_function
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S20
- Family
- Bacterial ribosomal protein bS20 family
- Protein Sequence
-
MANIKSQQKRNRTNERARLRNKAVKSSLRTAVRAFREAAHAGDKAKAAELLASTNRKLDKAASKGVIHKNQAANKKSALAQALNKL
- Mass
- 9,405 Da
- Length
- 86 Aa
Rv2412 doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.