PE25
- Type
- protein_coding
- Name
- PE25
- Locus Name
-
Rv2431c
- Product
-
PE family protein PE25
- Functional Category
-
Pe/ppe
- Location
- 2727967..2728266 (- strand)
- Gene Length
- 299 bp
- Nucleotides
-
ATGTCTTTTGTGATCACAAATCCCGAGGCGTTGACCGTGGCGGCCACGGAGGTACGACGGATTCGCGATCGTGCGATCCAAAGCGATGCTCAGGTGGCCCCGATGACAACCGCTGTGCGGCCTCCGGCTGCGGATCTGGTGTCGGAGAAGGCGGCGACGTTCCTGGTCGAGTACGCAAGGAAGTATCGGCAGACCATCGCTGCGGCGGCGGTGGTTCTTGAGGAGTTTGCGCACGCCTTGACCACTGGCGCCGATAAGTATGCGACCGCCGAGGCCGACAACATCAAGACCTTTAGTTA
- Drug Resistance
- Mutations
- Function
- The PE25/PPE41 dimer induces both a strong humoral and cellular immune response. PE25 protein alone induces low response (PubMed:18974870). The dimer induces necrosis, but not apoptosis, in mouse macrophage cells (PubMed:25379378). It also induces activation and maturation of mouse dendritic cells and drives Th2-biased immune responses (PubMed:26318856). {ECO:0000269|PubMed:18974870, ECO:0000269|PubMed:25379378, ECO:0000269|PubMed:26318856}.
- Family
-
Mycobacterial PE family
- GO
-
- pathogenesis GO:0009405 biological_process
- extracellular region GO:0005576 cellular_component
- InterPro
2G38
- Name
- PE-PGRS family protein PE25
- Family
- Mycobacterial PE family
- Protein Sequence
-
MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS
- Mass
- 10,687 Da
- Length
- 99 Aa
Summary
Rv2431c doesn't seem to be a targeted by any drug.
Rv2431c doesn't seem to be involved in any pathway.
- Structure of a PE-PPE-EspG complex from Mycobacterium tuberculosis reveals molecular specificity of ESX protein secretion.
- Proc Natl Acad Sci U S A. 2014 Oct 14;111(41):14758-63. doi: 10.1073/pnas.1409345111. Epub 2014 Oct 1.
- Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer.
- Mol Microbiol. 2014 Oct;94(2):367-82. doi: 10.1111/mmi.12770. Epub 2014 Sep 15.
- Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis.
- Proc Natl Acad Sci U S A. 2006 May 23;103(21):8060-5. doi: 10.1073/pnas.0602606103. Epub 2006 May 11.
- Mycobacterium tuberculosis PE25/PPE41 protein complex induces activation and maturation of dendritic cells and drives Th2-biased immune responses.
- Med Microbiol Immunol. 2016 Apr;205(2):119-31. doi: 10.1007/s00430-015-0434-x. Epub 2015 Aug 30.
- Mycobacterium tuberculosis PE25/PPE41 protein complex induces necrosis in macrophages: Role in virulence and disease reactivation?
- FEBS Open Bio. 2014 Sep 16;4:822-8. doi: 10.1016/j.fob.2014.09.001. eCollection 2014.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response.
- PLoS One. 2008;3(10):e3586. doi: 10.1371/journal.pone.0003586. Epub 2008 Oct 31.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.